ࡱ>  ubjbj<< (^^kmP 8dLZ(KKKKKKKnNQlK" K K K K {C0F!PD$3GK0LD|Q |QHF FtG ]:   Limited distribution IOC/IODE-XXI/23 9 February 2011 Original: [English] INTERGOVERNMENTAL OCEANOGRAPHIC COMMISSION (of UNESCO) Twenty-first Session of the IOC Committee on International Oceanographic Data and Information Exchange (IODE-XXI) Lige, Belgium, 23-26 March 2011 OceanDocs and Aquatic Commons Marc Goovaerts, U. Hasselt, Be. Pauline Simpson, U.K. and Linda Pikula, U.S. NOAA OceanDocs REPORT ON ACTIVITIES CARRIED OUT DURING THE INTER-SESSIONAL PERIOD IODEs OceanDocs is designed to capture and make freely accessible the research output from members of the IODE, Ocean Data and Information Networks (ODINS). It is a thematic digital repository of organization publications, scholarly materials, grey literature and other documents submitted by scientific researchers and librarians. It is an international, multi-institution open-access repository network, focused at present on marine and oceanographic literature. The OAI software employed is DSpace version 1.6 which was upgraded recently. OAI (Open Access Initiative) promotes free and open access to literature. In the international science community it is hoped to enhance scientific communication, make local and regional grey literature available on a worldwide scale, and facilitate publishing of research finds, specifically for scientists in developing countries to promote their research and increase access to the international research forum. Development of the repository network The OceanDocs repository contains at the moment 31 institutes in Africa and Latin America. During this intersession IODE and GEOHAB have added their publication collections to OceanDocs. The repository contains 3,359 submitted documents. In 2009, 362 documents were submitted an increased submission in 2010 to 520 documents is noted. Documents submitted to OceanDocs Submitted per year YearItems200484200577920062622007587200876520093622010520Total:3,359  Interest in the repository is growing. During the October, 2010 IAMSLIC (International Association of Marine and Aquatic Information Centers) a pre-conference training session in OceanDocs for Latin America was conducted, along with a presentation of the Upgraded features in DSpace 1.6. It is hoped that several additional partners will participate in OceanDocs. Usage: After analyzing the statistics and eliminating crawler downloads (30.5% of the downloads), we have had 403,520 downloads of Oceandocs documents in 2010. This can be attributed to harvesters like OAIster and AVANO, but mainly through search engines like Google. General overview of documents and downloads 2010DocsDownloadsAfrica1494208033Latin America1364181640International Oceanographic Data and Information Exchange IODE49114568 Africa: 5 most downloaded collectionsDocsDownloadsKMFRI - Kenya Marine and Fisheries Research Institute8919436Institut National des Sciences et Technologies de la Mer8017522NIOMR - Nigerian Institute for Oceanography and Marine Research7615286National Institute of Oceanography and Fisheries8015232Direction des Pches Maritimes / CRODT12014346 Latin America: 5 most downloaded collectionsDocsDownloadsInstituto Nacional de Investigacin y Desarrollo Pesquero (INIDEP)25460337Centro de Investigaciones Pesqueras Minist. de Industrias Pesqueras 17032142Instituto Oceanogrfico de la Armada24923138INVEMAR - Instituto de Investigaciones Marinas y Costeras2718927Centro de Bioproductos Marinos316867 The following presentations related to OceanDocs were conducted during the intersession 2008-2010: Development of OceanDocs and Repository in Pacific Islands, 13-17 May, 2008 Oostende, M. Goovaerts OceanDocs Network Policies, ODINECET Meeting, Oostende, October 2008 Goovaerts AgriOceanDspace, OceanDocs update - Mar Del Plata, October 2010 Pre-IAMSLIC Workshop Cristiani/Pikula VOAR3, Mar del Plata October 2010 IAMSLIC Conference L.Pikula OceanDocs -ASFA Mini-Conference Mar Del Plata October 2010 A. Cristiani OceanDocs and Open Science Directory: two facets of the information policy of UNESCO/IOC-IODE: Presented by M. Goovaerts at: ETD Conference, Pittsburg, June 10-13 2009 IAMSLIC, Bruges, September 30 2009 DSpace User Group Meeting, October 14-16 2009 D4Science meetings , Rome, November 25-26 2009 and December 16-17 2010 Capacity Building: IODE has conducted workshops to assist ODIN members and other IODE members in determining their repository goals, OAI software selection and offering participation in OceanDocs to those choosing not to develop their own repositories. The following ODIN Members have now developed their own repositories: Russian repository "Manakin" ( HYPERLINK "http://dspace.vniro.ru" http://dspace.vniro.ru) on DSpace 1700 docs IBSS(Sevastopol Ukraine): HYPERLINK "http://repository.ibss.org.ua/dspace/"http://repository.ibss.org.ua/dspace/ On DSpace - 1418 docs CEEMAR (OdinECET) (HYPERLINK "http://www.ceemar.org/"http://www.ceemar.org/) On DSpace 814 docs NIO (Goa-India): HYPERLINK "http://drs.nio.org/"http://drs.nio.org/ - On DSpace - 3725 docs ODINPimris (HYPERLINK "http://pimrisregional.library.usp.ac.fj/"http://pimrisregional.library.usp.ac.fj/ ) On Greenstone 352 docs ODIN Westpac started their own repository ( HYPERLINK "http://221.239.0.193:8080/jspui/" http://221.239.0.193:8080/jspui/). They will be invited to join the OceanDocs network in 2011. All these repositories are OAI-compliant. Some effort is still needed at NIO and OdinPimris to follow the metadata standards of OceanDocs. PROPOSED WORK PLAN AND TIME TABLE FOR THE NEXT INTER-SESSIONAL PERIOD For the further development of OceanDocs and its network some actions will be initiated. They will be in full development in 2011. First IODE, GEMIM has proposed to install a Coordination Group/ Steering Committee for OceanDocs. They will be in charge of the global policy and strategy of OceanDocs. Every ODIN involved will have a representative. The group will also contain some experts and representatives of AVANO (IFREMER), Aquatic Commons (IAMSLIC), Hasselt University, Aquatic Science and Information Abstracts (ASFA) and others. The DSpace software will be upgraded to 1.7. This will be included in the new version of OceanDocs, which will be ready in the first quarter of 2011. This will be realized in cooperation with FAO of the United Nations and result in the product AgriOcean DSpace (see below). The main goal is to strengthen the network of OceanDocs, besides simply following the technical evolution. The new version will include harvest functionalities which will make it possible to include the collections of partners in OceanDocs. Additionally, an easy-to-install version of OceanDocs will make it much easier for smaller institutions to set up their own repository, while still being compatible with the OceanDocs standards. Another feature of this easy-to install version will be library catalogue functionality. This will make it easier for smaller institutions to develop their own collections and should result in a larger volume of documents available in Open Access in marine, oceanographic and related topics. AgriOcean DSpace - Cooperation with FAO-KCEW The United Nations agencies of FAO and UNESCO-IOC have announced a joint initiative to provide a customized version of DSpace using standards and controlled vocabularies in oceanography, marine science, food, agriculture, development, fisheries, forestry, natural resources and related sciences. The collaboration between FAO and UNESCO-IOC/IODE has the following goals: Promoting open access to scientific information on the topics of food, agriculture, development, fisheries, forestry, natural resources and related sciences for FAO and oceanography and marine sciences for UNESCO-IOC/IODE. Ensuring the metadata quality of repositories and the use of thesauri and other forms of authority control. Contributing to the development of sustainable repositories by the use of tools to make scientific publications (and later data) more accessible and visible Removing access barriers by encouraging the creation of new service providers based on existing and mature metadata and semantics technology. The Hasselt University Library produced a customized version of DSpace called OceanDocs for the International Oceanographic Data and Information Exchange (IODE) and adapted it to the standards of the Oceanographic community. The OceanDocs Network, created in 2004, now has some 50 members. The Food and Agriculture Organization (FAO) of the United Nations customized DSpace using the AGRIS Application Profile (AP) and is developing a plug-in for the use of controlled vocabularies such as AGROVOC for communities in food, agriculture, development, fisheries, forestry, natural resources and related sciences. The communities supported by FAO and UNESCO-IOC/IODE are synergistic and the standards on metadata and controlled vocabularies are similar for both. A common repository development is a logical result. Hasselt University Library will create for FAO and UNESCO-IOC/IODE a new version called AgriOcean DSpace. It will integrate the previous developments of both Agencies in one customized version of DSpace 1.7, using the new features authority control, Solr based statistics and harvesting. The developments of FAO on AGRIS AP and thesaurus integration will complete AgriOcean DSpace. Finally an easy-to-install Windows-based version of AgriOcean DSpace will be distributed. AgriOcean Dspace will be available in the first quarter of 2011. OceanDataPub (now POD) IOC/IODE is, in cooperation with SCOR, setting up a data repository for long-term archiving of data sets related to publications in open access available in OceanDocs, Aquatic Commons or other aquatic repositories. The idea is to collect the data sets behind specific publications for conservation. They will be linked to the open access publications enhancing its scientific value. OceanDataPub will be available in March 2011. VOA3R European project OceanDocs is part of the VOA3R project with the Hasselt University Library as a project partner. VOA3R is the innovative research project for digital libraries and stands for: "Virtual Open Access Agriculture & Aquaculture Repository: Sharing Scientific and Scholarly Research related to Agriculture, Food, and Environment". The general objective of the VOA3R project is to improve the spread of European agriculture and aquaculture research results by using an innovative approach to sharing open access research products. That will be achieved by carrying out innovative experiments with open access to scientific agriculture and aquaculture contents and by developing and providing services that integrate existing open access repositories and scholarly publication management systems by means of a federation approach. Under a strict open access policy, the VOA3R service will connect libraries, archives and other publication systems by providing advanced search interfaces that include the specifics aspects of research work (methods, variables, measures, instruments, techniques, etc.) that are specific of the particular domain. The users of the VOA3R service are academics and researchers but also students and practitioners who either want to search for or to publish scientific research results (for these roles, learning material related to the application of scientific outcomes is also considered, as a sub-product of research). The project is targeted to the domain of Agriculture & Aquaculture, as it re-uses previous domain models for these domains, but the technology and models integrated are to a large extent transferable to other academic disciplines. The VOA3R platform aims at reusing existing and mature metadata and semantics technology to deploy an advanced community-focused integrated service for the retrieval of relevant open content and data that includes explicit models of the scholarly methods and procedures used and of the practical tasks targeted by applied research (which represent a principal information need expression for practitioners). The service will enable researchers to formulate their information needs in terms of elements of the scientific methods established in their field (variables, techniques, assessment methods, kinds of objects of interest, etc.) combined with topical descriptions as expressed in metadata. The community approach will enable the enhancement of information seeking with extended evaluation elements (as for example, ratings, public reviews, social tagging and links to supporting or conflicting reports) that complement and go beyond the traditional, anonymous peer review process which results are not made available openly. The technology used will itself become open source, so that the model of the service can be adopted by enterprises (including SMEs) or other kinds of institutions as a value-added, community-oriented model for open access content. Project type: European Research Consortium Project (ICT-PSP Programme of the European Commission) Project partners: UDE; University of Alcal, Spain; Agricultural University of Athens, Greece; Greek Research & Technology Network, Greece; Swedish University of Agriculture Sciences, Sweden; University of Minho, Portugal; Hasselt University, Belgium; International Centre for Research in Organic Food Systems, Denmark; French National Institute for Agricultural Research, France; Czech University of Life Sciences, Czech Republic; ACTA Informatique, France; Agricultural Research Institute, Cyprus; Consorzio Interuniversitario, Italy; Technological Educational Institute of Athens, Greece; Food and Agriculture Organization of the United Nations (FAO) Project duration: 06.2010 - 05.2013 Project website: HYPERLINK "http://www.voa3r.eu/" \t "_blank"http://www.voa3r.eu (under construction) Funding: European Commission Project budget: 3,600,000 Euro OpenOcean Collaboration Under discussion for future 2011 UNESCO Open Access Collaboration Under discussion for future 2011 D4 Science- Meetings attended in 2009, 2010 for collaboration, closed. Aquatic Commons 1. REPORT ON ACTIVITIES CARRIED OUT DURING THE INTER-SESSIONAL PERIOD In December 2010, within the framework of the long-standing collaboration between IAMSLIC and the IOC's International Oceanographic Data and Information Exchange (HYPERLINK "http://www.iode.org" \t "_blank"IODE) the IOC Project Office for IODE in Oostende, Belgium agreed to host Aquatic Commons as part of its efforts to promote free and open access to marine scientific information to the global community (which also includes its own OceanDocs). The cooperation includes technical support. IODE hosting began with implementing EPrints Version 3.2.4 with the official re-launch on 01 January 2011. The Aquatic Commons is a thematic digital repository of published and unpublished research, organizational publications and scholarly materials contributed by researchers and librarians. It covers the natural marine, estuarine /brackish and fresh water environments. It includes all aspects of the science, technology, management and conservation of these environments, their organisms and resources, and the economic, sociological and legal aspects. It is directed by the International Association of Aquatic and Marine Science Libraries and Information Centers (HYPERLINK "http://www.iamslic.org/" \t "_blank"IAMSLIC) to provide visibility, usage and impact through global access to digital publications from worldwide marine and freshwater organizations that do not have access to an institutional repository of their own. The implementation of Aquatic Commons was completed in 2007 under contract by the Florida Centre for Library Automation (FCLA) who hosted and developed the Repository to November 2010. Aquatic Commons is powered by EPrints open source software developed by the University of Southampton in the UK. Management for Aquatic Commons is now administered by a multi-national joint IODE/IAMSLIC Aquatic Commons Management Board. IAMSLIC and IODE believe that this hosting arrangement will promote the synergistic resource sharing efforts of both organizations and permit further development of joint repository services. Within the Aquatic Commons Board framework, three Working Groups operate: AC Metadata, AC Collection Development, and AC Technical Development. All communication is by e-mail. The Metadata Group has: monitored the Issuing Agency Authority List which has more than 75 Agencies represented. Geographically, contributions have been made from Issuing Agencies in USA/Canada 44, Latin America/Caribbean 12, Asia 6, Africa 8, Europe 5, and Oceania 1; Defined Deposit Agreements for individuals which is particularly useful for theses and dissertations; Defined new Object types and specified metadata formats Collection Development Initiatives: In addition to individual deposits several collections are being added. The FAO Fisheries Library staff is acknowledged for their dedicated efforts to increase the availability of African documents in Aquatic Commons under the ASFA Trust Fund Project. This ongoing project aims to retrospectively scan grey literature from developing countries for inclusion in the Aquatic Commons (AC) repository, add links to those documents already cited in the ASFA database, and create new ASFA records where they are missing. A copy of the publications in digital format is also supplied back to the originating institution. The first batch of URLs of about 480 newly created Aquatic Commons records and the corresponding ASFA record numbers have been sent to the publisher CSA Illumina, to enable full text linking from ASFA to the Aquatic Commons. The possibility of importing metadata directly from Aquatic Commons into the ASFA software is under consideration. Under this project, digitization started of the Conference Proceedings of the Fisheries Society of Nigeria (FISON); 24 volumes have been published since 1981. Also, FAO is digitizing and uploading documents from the Lake Victoria Fisheries Research Project (1998-2000), reports published by the Nigerian-German (GTZ) Kainji Lake Fisheries Promotion Project between 1994 and 2004 and issues of the Bulletin of the Institute of Marine Biology and Oceanography, based in Freetown, Sierra Leone, published between 1976 and 1993. In addition, Germany are adding the fishery series Informationen aus der Fischereiforschung = Information on Fishery Research which was initially published by the Bundesforschungsanstalt fr Fischerei and from 2010 onward by the Johann Heinrich von Thnen-Institute, Federal Research Institute for Rural Areas, Forestry and Fisheries. There are currently 299 issues of this series in Aquatic Commons. Tech Group: Technical enhancements based on the 2008 FAO FishCode Programme funded requests were completed. The following enhancements to the Aquatic Commons functionality are now in place. Public search, deposit and help screens in French and Spanish The Issuing Agency field is now browseable and re-indexed each evening. Consistency in the name is prerequisite for comprehensive retrieval. AC in a flash is a standalone offline, batch input program which was developed for contributors with low bandwidth and unstable internet connectivity. Written by Liang Zhong of FLCA, this programme allows an individual to fill in the metadata fields and upload the accompanying digital file on a flash drive and then send the drive to an editor for uploading into the repository. Digital files should be created on the users workstation before uploading to the flash drive. 40 flash drives containing this programme have been delivered to the FAO Fisheries Library in Rome. Its official release was at the 2010 IAMSLIC Conference. Statistics on the Aquatic Commons Repository This graph from ROAR [http://roar.eprints.org/cgi/export/eprint/54/ROAR%3A%3AActivity/roar-eprint-54.png] shows the rate of deposit of items. As of December 2010, Aquatic Commons had over 3999 items in the repository.  The total of file of individual downloads from August 2009 to September 2010 was 93,348. The chart below indicates downloads per month to Sep 2010.  Downloads by country are shown below.  Total unique visitors are shown in this graph. In August 2009 there were approximately 380 visitors; in August 2010 there were 900 visitors.  The search terms that were used most frequently during Jun-Sep 2010 included: Search Terms CountFish culture119Pond construction and design86All86Florida department of natural resources34Fish culture in india33What is fish culture26Condrictios33Earth pond construction20241717Recirculatory system17 Rankings: In July 2010, Aquatic Commons was ranked 182 in the Ranking Web of World Repositories: Top 800 Repositories [HYPERLINK "http://repositories.webometrics.info/top800_rep_inst.asp"http://repositories.webometrics.info/top800_rep_inst.asp] In 2009, Aquatic Commons was ranked 259 in the World Ranking of Top 400 Repositories 2. PROPOSED WORK PLAN AND TIME TABLE FOR THE NEXT INTER-SESSIONAL PERIOD The ASFA Trust Board Project Fund will continue to enable the scanning of historical grey literature from developing countries, as well as from the Freshwater Biological Association, UK, who are digitizing approximately 500 FBA Technical Reports and other grey literature.Digitized copies of thesedocuments along with metadata will be submitted to the Aquatic Commons repository between November 2010 and April 2011 The critical activity in December 2010 was the migration of the Aquatic Commons to its new host. The Aquatic Commons will remain an HYPERLINK "http://www.iamslic.org/" \t "_blank"IAMSLIC product and content will continue being managed by IAMSLIC. It will be hosted and technically supported at the IODE Project Office in Oostende, Belgium, overseen by a joint Aquatic Commons Management Board. Thanks to Aditya Kakodkar, IT Expert at IODE and FCLAs Priscilla Caplan, Liang Zhong and Bill Kuntz it was a seamless migration and transition process. IODE have already implemented an upgraded version of the EPrints repository software and during the inter-sessional will cover upgrading to any new versions of EPrints. New functionality or bespoke customization of the software will be discussed and agreed with IAMSLIC. Hosting both Aquatic Commons and OceanDocs repositories, gives IODE the opportunity to develop new products and services and implement new linking procedures a close horizon may be text and data linking. The exciting VOA3R European Project involving OceanDocs may offer an opportunity for Aquatic Commons as well as OceanDocs to contribute toward building this resource for the greater aquatic and marine community. 3. REQUESTED FUNDING FOR THE NEXT INTER-SESSIONAL PERIOD OceanDocs Recommendation to approve the creation of an OceanDocs Steering Committee and establish funding for the first meeting of the Steering Committee. Aquatic Commons Aquatic Commons is a joint undertaking of IAMSLIC and IODE. It has been agreed that any developments to AC will be jointly funded. A contingency amount of US$3000 should be allocated to cover IODE staff, training, version upgrades and bespoke customization. 4. TEXT FOR THE ACTION PAPER Ms. Linda Pikula will introduce this Agenda Item by referring to Document IOC/IODE-XXI/23(OceanDocs and Aquatic Commons). OceanDocs IODE, GEMIM has proposed the implementation of a Coordination Group/ Steering Committee, which will guide the global policy and strategy of OceanDocs. The group will contain some experts and representatives of AVANO (IFREMER), Aquatic Commons (IAMSLIC), Hasselt University, Aquatic Science and Information Abstracts (ASFA) and others and each ODIN involved will have a representative.. The ODIN representatives will provide support to organizations within their own regions. The OceanDocs Coordination Group will also support the actions in the VOA3R project. The OceanDocs software is upgraded in a common effort of IOC/IODE and FAO of the United Nations. Further developments in the next two years can be realized in the framework of VOA3R. The focus in the next two years will be in the distribution of the easy-to-install version of AgriOcean DSpace to organizations who want to control their own repository collections. At the same time OceanDocs will integrate these local collections in the central repository through the new harvesting/mirroring functionality in DSpace. Finally the possibilities to integrate and interlink OceanDocs with other IOC/IODE products will be the main challenge for the next years. Aquatic Commons In December 2010, within the framework of the long-standing collaboration between IAMSLIC and the IOC's International Oceanographic Data and Information Exchange (HYPERLINK "http://www.iode.org" \t "_blank"IODE) the IOC Project Office for IODE in Oostende, Belgium agreed to host Aquatic Commons, the IAMSLIC thematic digital repository, as part of its efforts to promote free and open access to marine scientific information to the global community (which also includes its own OceanDocs). The cooperation includes technical support. IODE hosting began with implementing EPrints Version 3.2.4 with the official re-launch on 01 January 2011. The Aquatic Commons repository is expected to continue in growth and use. Upgrading and customisation to the software will be carried out during the next inter-sessional period. The IODE/IAMSLIC Aquatic Commons Management Board will work with the OceanDocs Steering Group to maximize interoperability and mirroring of such things as metadata fields and vocabularies and the planning of products and services which utilize the content and functionality of both repositories. Management for Aquatic Commons is now administered by a multi-national joint IODE/IAMSLIC Aquatic Commons Management Board. IAMSLIC and IODE believe that this hosting arrangement will promote the synergistic resource sharing efforts of both organizations and permit further development of joint repository services. Recommendation 1: It is recommended that the implementation of OceanDocs Coordination Group and Steering Group will be agreed at IOC/IODE-XXI. It is intended that the groups of representatives will meet during e-meetings. However, it will still be necessary to have face-to-face meetings on a periodical base (every two years ?). It is recommended that a first meeting for one week be held during the period June September 2011. This first meeting will focus on the OceanDocs structure and policy and on the participation in the VOA3R project. Recommendation 2: It is recommended that an amount of US$20000 be allocated for the organization of the OceanDocs Start Up meeting, to cover the travel cost and per diem of the participants as well as the organization costs. The VOA3R Project can contribute US$10000. Recommendation 3: It is recommended that an amount of US$5000 be allocated for the software used in the OceanDocs Network (AgriOcean DSpace) to be kept up to date. VOA3R provides a framework of standards. The OceanDocs Coordination Group will define the future needs. (VOA3R funding: US$5000). Recommendation 4: It is recommended that a formal agreement is established between IODE and the International Association of Aquatic and Marine Science Libraries and Information Centres(IAMSLIC) defining Aquatic Commons, ownership, stewardship, hosting and technical responsibilities and Terms of Reference for the new Aquatic Commons Management Board. Recommendation 5: It is recommended that an amount of US$3000 be allocated to co-fund with IAMSLIC developments to the Aquatic Commons; to cover IODE staff, training, version upgrades and bespoke customization.     IOC/IODE-XXI/23 page  PAGE 2 IOC/IODE-XXI/23 page  PAGE 3 Pz{ 8 9 Y h { 24Ľĵzogogogo[ogohbz,h U5CJaJh UCJaJh/h UCJaJh U5CJ\aJh/h U5CJ\aJ'h?Ceh U5CJOJQJaJmH sH hfth U6CJ\aJh;h U\ h U5\h#(h U5\h#(h U5CJ(\aJ(h U5CJ(\aJ(h UOJQJ^Jh U5OJQJ\h UOP{  9 $ & F & 0` P@1$7$8$H$gd U^gd U! & 0` P@1$7$8$H$gd U$$ & 0` P@1$7$8$H$a$gd Ugd U$a$gd U 9MRXY^mQkd$$If0BB t634a $Ifgd Ugd Ugd Ugd U% & 0` P@1$7$8$H$^gd U 9:MXYabkluv+\kl]^¬¥¥¥¥¥¥¥¬¥„p¥¥¥¥p¥¥'h/h U5CJPJ^JaJnHtHh UCJPJ^JaJnHtH h/h UCJPJaJnHtH h/h U*h/h U5CJPJ\^JaJnHtH$h/h UCJPJ^JaJnHtH*jh UCJPJU^JaJmHnHu'h/h U5CJOJQJaJmH sH *^abgklquDQkd$$If0BB t634a $Ifgd UQkdj$$If0BB t634a$$Ifa$gd Uuv{DQkd$$If0BB t634a$$Ifa$gd U $Ifgd UQkd>$$If0BB t634aDQkd|$$If0BB t634a$$Ifa$gd U $Ifgd UQkd$$If0BB t634aD==gd UQkdP$$If0BB t634a$$Ifa$gd U $Ifgd UQkd$$If0BB t634a*+\ak$d$If[$a$gd Ud$If[$gd Ugd UklsxN;))$d$If[$a$gd Ud$If[$^gd Ukd$$IfF+%F(FF6    t0S%6    34aptaOO$d$If[$a$gd Ud$If[$^gd Ukd$$IfF+%F(FF6 t0S%6    34ataOO$d$If[$a$gd Ud$If[$^gd Ukd$$IfF+%F(FF6 t0S%6    34atmbPP$d$If[$a$gd U $Ifgd Ugd UkdD$$IfF+%F(FF6 t0S%6    34aTW]N;))$d$If[$a$gd Ud$If[$^gd Ukd $$IfF+%F(FF6    t0S%6    34ap]^taOO$d$If[$a$gd Ud$If[$^gd Ukd!$$IfF+%F(FF6 t0S%6    34a^%&MWXY56ef78:wֻ֧n]!h U6CJPJ^JaJnHtH'hh U6CJPJ^JaJnHtH$hh UCJPJ^JaJnHtH hh Uhh UB*ph'hh U5CJPJ^JaJnHtH'h/h U5CJPJ^JaJnHtH h/h U$h/h UCJPJ^JaJnHtH,h/h UCJPJ^JaJmH nHsH tH!taOO$d$If[$a$gd Ud$If[$^gd Ukd$$IfF+%F(FF6 t0S%6    34a%taOO$d$If[$a$gd Ud$If[$^gd Ukd $$IfF+%F(FF6 t0S%6    34a%&MQWtaOO$d$If[$a$gd Ud$If[$^gd UkdR $$IfF+%F(FF6 t0S%6    34aWXYtmbPP$d$If[$a$gd U $Ifgd Ugd Ukd $$IfF+%F(FF6 t0S%6    34aN;))$d$If[$a$gd Ud$If[$^gd Ukd $$IfF+%F(FF6    t0S%6    34ap+/5taOO$d$If[$a$gd Ud$If[$^gd Ukd $$IfF+%F(FF6 t0S%6    34a56[_etaOO$d$If[$a$gd Ud$If[$^gd Ukd $$IfF+%F(FF6 t0S%6    34aeftaOO$d$If[$a$gd Ud$If[$^gd Ukd`$$IfF+%F(FF6 t0S%6    34ataOO$d$If[$a$gd Ud$If[$^gd Ukd$$IfF+%F(FF6 t0S%6    34a6789tmmme\ $$Ifa$&$Ifgd Ukd$$IfF+%F(FF6 t0S%6    34a9:T=\e! 2( Px 4 #\'*.25@9gd U! 2( Px 4 #\'*.25@9gd Ugd UQkd$$If0Z#BD t634aACS[;\ !"#ʶxdxWxWdF!h U5CJPJ^JaJnHtHh U6CJPJ^JaJ'h~Vh U6CJPJ^JaJnHtHh~Vh U6CJPJ^JaJh UCJPJ^JaJh~Vh UCJPJ^JaJ$hh UCJPJ^JaJnHtH'hh U6CJPJ^JaJnHtHh UCJPJ^JaJnHtH!h U6CJPJ^JaJnHtH'h6h U6CJPJ^JaJnHtH\!"#67"#$%&'mnl1w & F gd U & Fgd Ugd Ugd U$ & F 2( Px 4 #\'*.25@9gd U#4!"#$'lmnȯ؟rrer]J7$h/h UCJOJQJaJmH sH $h*h UCJOJQJaJmH sH h UCJaJh*h U0JCJaJjh*h UCJUaJh*h UCJaJ$h/h UCJOJQJaJmH sH h UCJOJQJaJmH sH 0hz)h U5B*CJPJ^JaJnHphtHh UCJPJ^JaJnHtH$h/h UCJPJ^JaJnHtH'h/h U5CJPJ^JaJnHtH./TUV`kl'01=>rs˻ˬ˻ˬy˙f$hh UCJOJQJaJmH sH (h/h U0JCJOJQJaJmH sH h6h UmH sH $h/h UCJOJQJaJmH sH h/h UCJOJQJaJh UCJOJQJaJmH sH $h/h UCJOJQJaJmH sH (h/h U0JCJOJQJaJmH sH h Ujh UU s789uvkUA.%hbz,h UB* CJaJmH phPsH 'h6h UCJOJQJ]aJmH sH +hbz,h U0JCJOJQJ]aJmH sH (hbz,h U0JCJOJQJaJmH sH -jh UCJOJQJUaJmH sH -jhbz,h UCJOJQJUaJmH sH $hbz,h UCJOJQJaJmH sH hh UCJaJmH sH $hh UCJOJQJaJmH sH jh UU(hh U0JCJOJQJaJmH sH vwIJK l m s B!\!m!n!w!x!##V$W$$%m(O*P*X*_***++f,,,,Ǽըݕ݊|h U5B*CJaJphhz6h UCJaJ$h/h UCJOJQJaJmH sH 'h/h U5CJOJQJaJmH sH h U5CJ^JaJh/h U5CJ^JaJh UCJaJh/h UCJaJ-hbz,h UB* CJOJQJaJmH phPsH 0wJKg W$$%%&B''m(*---{/ & F gd U^gd U% & 0` P@h1$7$8$H$^hgd U$ & F & 0` P@1$7$8$H$gd Ugd U,,-N-X-g--------{////;;s;;>>%>5>6>7>c>d>w>x>>>>>>~~~~vrvcv~~~h/h U0JCJ^JaJh Ujh UUh/h UCJ^JaJh/h U0JCJ^JaJ"h UCJOJQJ^JaJmH sH (h/h UCJOJQJ^JaJmH sH h/h U5CJaJh U5CJaJhjh U5CJaJhjh UCJaJh UCJaJh/h UCJaJ#{///2!6;s;>%>>>>?J????FB DEFGHOJPJ ^gd Ugd Ugd U & F dd[$\$gd Ugd Ugd U>)?I????????@@@@@@CPC~DDDDDDEEhFsFFGG/GɻraSah UCJOJQJ^JaJ hfth UCJOJQJ^JaJ hfth U0JCJOJQJaJ hfth U0JCJOJQJaJh Ujh UUhfth UCJOJQJaJh UCJOJQJaJhfth U5CJ\aJh U5CJOJQJaJhFh U5CJ OJQJaJ h U5CJ^JaJhL%h U5CJ^JaJ/G1GGG]M>]M>]hfth UCJPJ^JaJhfth U5CJPJ^JaJ hfth U"hfth U5>*CJPJ^JaJhfth U5>*CJPJaJ$hfth UCJOJPJQJ^JaJhfth U5CJPJ^JaJhfth UCJPJ^JaJh UCJPJ^JaJh U5CJ^JaJh UCJOJPJQJ^JaJ@jhIh UCJOJPJQJU^JaJmHnHsH tH uZX[X\X]XXXXXXGzkd$$Ifl,0# t0644 la $Ifgd Ugd U,$ & 0` P@01$7$8$H$^0`a$gd UXXXXXXzzkd-$$Ifl0# t0644 la $Ifgd UXXXXzz $Ifgd Uzkd$$Ifl0# t0644 laXX$Y'Yzz $Ifgd Uzkd?$$Ifl0# t0644 laX$Y'Y(Y>YAYBYWYZY[YgYjYkYYYYYYYYYYYYYYYYY Z$Z%ZiZjZZZZZZZZG[rhfth U5CJ^JaJhrh U0JCJPJaJh Ujh UUhrh U5CJPJaJh UCJPJaJhjh UCJPJaJhjh U5CJPJaJh U5CJ^JaJ hfth Uhfth UCJPJ^JaJhfth U5CJPJ^JaJ)'Y(Y>YAYzz $Ifgd Uzkdȸ$$Ifl0# t0644 laAYBYWYZYzz $Ifgd UzkdQ$$Ifl0# t0644 laZY[YgYjYzz $Ifgd Uzkdڹ$$Ifl0# t0644 lajYkYYYzz $Ifgd Uzkdc$$Ifl0# t0644 laYYYYzz $Ifgd Uzkd$$Ifl0# t0644 laYYYYzz $Ifgd Uzkdu$$Ifl0# t0644 laYYYYZZZZZG[\\UUU\\\gd U) & 0` P@01$7$8$H$^0`gd Uzkd$$Ifl0# t0644 la G[H[\\__+`,```aaa bbbbbbcccccYdgd U! & 0` P@1$7$8$H$gd Ugd UG[H[x[[[[[[\\Z\[\\\]K]N]q]r]]]]]]]]]]z^{^|^}^^^Ź޹޹޹wiii^h\9h UCJaJhth U5CJ\aJhth U0JCJaJh Ujh UUhth UCJaJh\9h UCJPJ^JaJhfth UCJPJ^JaJh UCJPJ^JaJh UCJPJ]^Jhth UCJPJ]^Jhth UCJPJ^JaJ$hfth UCJOJPJQJ^JaJ!^^__,```````aaaa b bbbbubvbbbbbbcccðukuku]kPkPh?:h UCJ^JaJhFh U5CJ^JaJh UCJ^JaJhT6h UCJ^JaJh U5CJ^JaJh*yh U5CJ^JaJhh U5CJ^Jh U5CJ^J$hfth UCJOJPJQJ^JaJhfth UCJPJ^JaJh~_h UCJaJh Uh UCJPJ^JaJh\9h UCJaJh UCJaJccccccc6d8d9dXdYdcdoddee&f,f3f7f=f>f&i'i(i8iiiķթՒo_PHjh UUhfth UCJOJQJaJhGgth U5CJOJQJaJhh U5CJOJQJaJh UCJaJhh UCJaJhh U5CJaJh U>*CJ^JaJh&Uh U>*CJ^JaJh&Uh UCJ^JaJ!h%Qh UB* CJ^JaJphPh UCJ^JaJh wh UCJ^JaJhh U5CJ^Jh UCJ^JYdcdfLg'i(i8ikmnp r2sthuiujukumunupuqusutuvuwuuugd Ugd Ugd Uijj j jbjjkkkkkl lmmmnnnnn:p@p\pdppq rԺ}m]P]P]m]h U6CJOJQJaJh'.wh U6CJOJQJaJh'.wh U5CJOJQJaJhfth UCJ^JaJh UCJOJQJ^JaJ hfth UCJOJQJ^JaJ h9h UCJOJQJ^JaJh UCJOJQJ^JaJh UCJOJQJaJhfth UCJOJQJaJ hfth U0JCJOJQJaJjh UUh U rr0s1s2s@sBsEsstttttttt uuuguiuʸrrbbRrD9DRh U6CJ^JaJh wh U6CJ^JaJh wh U6CJOJQJaJh wh U5CJOJQJaJh U6CJOJQJaJh`Gh U6CJOJQJaJh UCJOJQJaJh U5CJOJQJaJh`Gh U5CJOJQJaJ"h U6B*CJOJQJaJph(h'.wh U6B*CJOJQJaJphhjh U6CJOJQJaJhjh U5CJOJQJaJiukulunuouqurutuuuuuuuuuuuuuuuuuh U0JmHnHu h U0Jjh U0JUh Ujh UUh U6CJOJQJaJuuuuuugd Ugd U) 01F:p U|. A!"#$%n~/SPNG  IHDR,,"sRGBIDATx^ylU_hH5De j  ,U(T TBV0 .P`B@4Q}P7BJ֊#'ܹ93sdy|93w<#18x!" 8"d@ `09 €{ B&С}͛uٲe{LO1b։^k֬~˗?^,~wÆ رc]]]=p!šRhH3\EE6O<ď>ѣ"YfΜ#'4"TF .T۔FMFH}TիSi0Wer>-Za-T2fz1cw7 DnJWOլ4(3^RFc@!SNh)ROO`1 SД DXB"4%E;D0%ybԌ<6o޼TR]'A28K;]QQQd8uČC.@8'"ǙhRƀF-90r)cq#QD1@q(D"\p ¸ex"GF.e 8na2J<##270n%@K^xᆱ*SfJ@/BMTKK˲e*++Php7z;|pMU eEz]w-YD L q#`$BYN>}„ SIQ)}dd1eօIN =fKU&/xjEpy5SYYAU&# `B@ B̟?_n*Te2!KЋP(/?|eLpizX  `MZ#@n8b5::B D#V `MZ#@n8b5:4ÏKE"=cN} €% " 8"d@ `09 €{ B&N!" 8"d@ `0zVWWwڵGRF4 E(:thu2ٱЋpΜ9Teb2A!7nܘᏪL)EeSU&CmaNL)Sy_]-cL9Ue4IF P4 L]_ڜ df0!*Ɣ*$Te2!KЋ0$ؕ(U ZzjM@ti@+BK Pп @#I(Dvx 䂑$"Lh ;<axrHJ&40<`$ %xD\0@ M";];䍥iqeظ#>): Ys1NJF՗s׮]---Z4R*RСC|I׮]GA,@ 9ܜ pȐ!Bm˖-%%%Gȟ?,@ anMbxBߏl-`D&Lm !@'@LC "obMM.Ν{_?~…׮]+?.KSSŸ<鷋tի sNܕ'/ڛ0aûtwυJF>MↆCN8OEr=rHH޽ev"MEt?2Jyj\#.lѢE~XN|/_.?+~"QyB믿| ?.O[oݱcXꫯw.{3gN]]ݻw+ ʹ h +**"K 9s=6lp{֭O?$x`̘11c9˃2K.dժUz s{x͛7曟.?qJ:uz+}v믿ؔoڴIη֭s"&g?3u8e{̙wH7ܧO%K|cǎ>}Cr!?@9Sd>}83]A7xC~R.d5\#'YgN\y~R.zO?Tt.렫*Oen/I ܺZ?x𠬩*++e֊q9<"?PI<=z](yGΊNRBUr%" XDBz+gu~G}T XԘ.d.ٟʯ]vѶto۶mrS@j"gnڴ*Nv Ξ=L&߿?c TeQΝ4.EP ˖-KMM)T͐) `@`JJ+*~G~^^ ӠYuXt?3CSrE׆+ںuy*h{)lCLMMecɖMTR)I]:u'R#R\u3߽{7_ZZ.zA`H`8EP1.@֭[Ihl*Px ڡ/.,vOי3gHZ&MƎ[XXXPPPFFtQٲ-U0k:`Fr5twoooT]YgK>qOtN_ Y:jv ,Mty;C,ӕCtQr+kOuBBB\]]2)d"U*#,7))Il57_r=o$0t)-}rȑj ! ݔ!`)@Ut$(_tϏNQ^^^tɓ\tY{mccC߹W%$$T.Wg.]ʯfk׮NOQ燅QK._ޢh+ K+pw*"=x }>è- 8\/K/%K/Jzt |@,,,ߎ;-iAjжm[:>DNѥzln层ŋ[[#iD:H\`%UT)*&OL t]JE7|2kI`͝;ޢD۷r=(#K5#|tUa=>!M@$>@NR}@A$Sb- @(P`b$ @b)B1b @@8%iB If B X& @P`i+ @PZjSpĤgAA~~냃#~jYYŐ!+qxj@79XoK:w@Wٚz+ @@8料kzGZ. J N/ϯ.ŭ6-q1{33f,?C&M: $6-Z&Lgo3 0ONgeK~VixFxm`o}_དྷZ"Iǎߤ:uZZGU=yΞ [q[,W[zWaϪF =z/ousxczqzURj'J>ӔT~9~֯8f^UKJzުg#[xUh@ edE6s-ULesѦ|d_]x^ɧQFK rdk\*-ThtEn,SsԨ=NMtvn"ѣ":cG܆ ΜDoٳD"IKK=A Tݝ*M.^so#E X3KnRQUrܮ*3!*\;%VYYNNjw/?4ݻGUWԒ+>vwQJ=IUmn* `/)փ$O'&%mMKQE}/,͜͝`URd:俒O-=##iO%Cg ۵jUP׮ՙpXu}{|D@ MgvLJe#Kn,^mpdNdUbR]x^ɇQkΜc_wzz?_tm‘#{Aɐ7^y3O`c(/*zB:ouKڼy=m @@u2?:/7Hޑy.T]ɇQkt6v ֞8qnl1 ^ҥR]jf,%`&p @@D(D4Y q ," @EeŇ_1W3W,yo_-IcZ\ߙi4(9'+YstX<   ?r !T _{ҝIl[c#XXZ&8N`k3m}_XJ f T`xium2 S'J~= .8>J6Q(xB @H~SCJL/^W BO $%R5x^~cNϝJʀ~Ihed89[NNYY•< P`B3@.P^Yhе 6UT-L[(G%lInZ픷ٻSc|c&7<9eRB%Xt @ E 2#q-霝ʽ(`ø;Lci8_ed :|E ,Ph@v + '1$F~63jJq `'N",N ֪}`ȜHzbd%`P`B3@%PPQ~>W} N ſ[Mjm6 qޫVoFDE5K2lz2?wd<%+yF"*%Hz1oݺuĉm 쥺q(^Z=mߛ/y-M[] `; @@UݨUgՕc_(燭!@PW:̪UtSGR8ۥPC%@ C˞GbnJ?P`<" @&{|w+SoO zD"ȁ_(9 @(, 24yi?(} Y_; A@[d @ f7لψ>0M(f* @@Jq=?׶YC/p] Zl #Xt*PCC65iJ7eЧW ,4 @@-VoV{amKXh @*XtJ_s,Y$@g?ZPs悈LA6u7 ww7H! KNW&N=yVڬŠB_(燭!@\u@uշ i37CS!@Xwݳgٛ2~H&9y@#j x @;9>K˺6"E.s[Fޥ.  N65 S*}>88"?{bȐHGǕ S]̙{z?H jz;V<,$F.i7:hmZI ۝;lpM XִiQ^^ ݛ7kfyi_2i3Ć @NS7:QChٹ\ EEd.Zt|ժA}m}tYl[Xz6H SLpS͍삦*{/^j3},}C5&(D7e ys];hܖG?6zl2oB mۙi~l}>*rx xyYn[/;s39m㶢N7\DkU]% ]ΥF3_{ҝI,@@ZIg,Vu%X| OݭXz9dO61nyR̕>$=F/;F ,>Jh@7_~ŝor[-h9C42ZsU7ɲ(p6sNNYYC@MjUٔ$FinUop[v:KΨ1 @@@qEq\4=:Fч*Tڶ0|y.,ɤtbOh((  @@g,gi/y:և kR\}ԃ҃,:m#s"EDvD]+@⣄6  |hnڼiKV{+3WmWg汍52?:/;BRu%.X| n/+mmOv:Ѣ#knob3Sue]cV@1_Ј)ˡ 1jHZEa涛5=&C} tDB.O?j?TDr8%i@  dflgmBr(K@S qTie)v9TLUxYޜ "@&[wO7Ӥ]i•W(x1 @@\w||ݺ׃hQ`$"@ c:je  18 hW`ǣt0&SkN@+t.tCI2(D2Q O@ u2ZiR&5 @koox1P`#k@OŠBz UgIl,Q Kӄ !@ dd_ ہm۩҅-L[@P`5<ƅ ,0T~rKτמ^{VL;3FWYXS^S ]JʿW'ȍjklKKڍ+@Fk†XPiU[#FuI%?E>Kf9@ ЕU4ZueUm#(AX", @+@ce ><2;kdgCipX > P-Ϲ?߽ԟ,8Yzx-(P`b$ @fI果=ttˬ/'ߞ<4y(UT㻿~ģ+v&=-nǐӉEZ <Š»w&1gͤVg>w$(xiv90^NH ,  %tSl}_|༒!;Yt]mlz/k=> iXE GGHUMWJzz u<4yVm,E*K!zR01fa 4ǹȬ:Zt\j1R_.r굦ZiF ,P` Y%Y#_F+W&'xf 'K|s!@@F}S=n*d=P`Cʩ~!燉&O=c:,] Йـ8_x3Oΰ-.ZtLl\_d%Q`BK@b?StwWZ J]w`@!Kf{דLbC2q[hGg,V([% @EeI!,74nUŖ 6=ܴ/]S[oOSrweX&_;J{jb>>-L[Pt={/_[㣤Q•E -!@@ ˫$} GiCS@\ӭ2ƨ鋗g,*+ʜ*0KM!aaF/r]D^ 3p{`-:K %[QlV5GNNY:V([% ]IH+N[PlY运tꞟnHJtnuէO_|nͺnK?sl|(Q-5ϳ>_嶊957frɓS&kOURYY޵ڳD"IKK|֭'NTH ySZ ?ND A>> ,MٳN SNN. nՆ}*YބI׮/[۝;qqEElIt!Y*5K*V1܍{@7RgU]DeȊjzg= l@@qL9н ҡI6J{%ժlWeeU3::bB^X:+ 6=g; H^{>x.Rj$ HTm88N[^]f2p.F_̣G]FǮ*,NRNtUYr9"";".DJ([% TA7nAuՋI/*|Όh`MK+V?uP .d/RRX-E=d 1g7?Mݗ<:/$cfl.zzGטY] 3eD| =\0C7h~QQ7ٻ5_jP>n7;v_~~1W؃S )@ 2&ZE tyݖ{{ {%cm`.rtDRiY$ C;vtu.,V StA@[8rhYU&Q6OrXϊΚ5pܹnpL%17xl oF4-6JSG?~;>E(_k֌1:GL_͞]u_1M}-\PDJQQf;vmp̙Y,M횚`iS\ ܦA;mSUkJʪ]v5l"KH `D5X w:i.*pr?~C;'!!P CtOm:/!-Jya8C{ B`Ȫ3q!!j;fg۝҅\tՎ BKW}+6Vktmm!m֜9\](**5~۾=o cUC^[hv{ݒ%x5:6@```cC`@h#lW"1ﵽX˖XQk}#G^]pϸq _0߿qv.)@ Q^=j_>ɯ9fYXz8 x+'SfV=:= `aa` PϞC=(o @@5+nȾlؓ7SD F 8uQEtCvф@!O?'  F:|8|9Z$XB @@.\_q{ Z}H>gVch@%y'Nܺ1 , '[X3n}iZ m @%@($[{Hz(qݴkztW*P)`[K (!Z/ =oZ.lLW]u6eeJ)#@ ,q~b;1:${M⨄Zf-߷p*U;-q0q+ YXDot-6]_5 i@aE!P]`7obDaa< ,Þd\ ,;} ˃V:@`*ʃRCEs!P%   ZSj2ZEEBҗD {̀| 2<d ! 'aNgsl دc?Q\QLJLyn,3ND% kvP`iAЅ@YeޜtP6}Pb @ ,Th@@tȊn6Gip$/ۿ, , '0|11efCo16嶍 -RZG?friPr__prp~y>࿒ ,Ph@_슢0rs͎i)̴a~_zҝI,@888c+y&'Ah?5L=uڝi;`AgSRVz%IiDQ! x -(̞=g}xQ(UWLO(4 P%+چWr/voz_qU76tS[na @nQݣ foed89 'SK_?< &)n%j,1Q4bQ-5)$^ |qsla/ڛ:Bn3cWC V#kb[=Se@R幡&`&Kts'K tKju՟=t. { TpIvx:v1mِaal@~(燭!C=pqq Z.) X1jk `p$0)EdѢu#CC@)I@@5yGl7h [Az' -NON =Knbz(A 2G**2q-tȠc" @, @h>ZTM-@g(ɸ[|wݹm܍ ,aL iǶЫob'?m&=K@$  m Ѓ>L00=MkjFeQlm~!@01מ^r=z7M]R ܏[Q"D `Э:=rcӺ>}vr]a6|m&K`p #s,F[L׋ W_) _`vlUz mXz0Hs /mLX!@@(o !`7. P%  E ,ly>vbFg!톈cB@{OiK8sH  XqwЏr<(}Ұlc#: PXæ+U/Ohdx@+`C8Tie)}Do\c#@@l(6c ,9.s /LDN=҄ >۪=hnhh*{`~y~|Q<-m6kеA{s Y^PM kN0  N65 JE/*+2$qeBCnŠ8!){whPZ>9?\z:J^& UU` ܹ7qSmz,^|uڴ(//DŽ|+A*˦ߙ:t=1JSá@@*zpqvn"GsͰ?/*&{wѢV macc jkTN~afi&]ekKV-sD †4. x\K vT:["ZѴYu-Hoiii[n74ػȑ7jKqɀ?ܦTI3m@[sz۴)xGVxw֬… ]%@Ym~x 'ޞiKQQ͆ yV>=s9=zԩݽ744^SnJ+\YgW ,Ph@NYAӧ'r+PiT/ߵIFIÜLJI'A,XfEx֍>O4rWy 1sjo'L^6(@& cYJ8oS| CG%ɸi3j6alBQkO2KE |6(xB tvSFn l:EH/Z3`ȜGDdGUy_J(xB \nfKo{s\c\^Bt^ow%=X:e>[$-#~^vvJVTDʀMسmdPϔ@+cH|m3[qQaN2Av0}Y ,_d-wUXuo @^Y,B[C@P`i@;fT#XE ؄ @@",OX9 /,1`WCK@@ ,  pd 0ht7}zՍ=TRo+UG`l)Wu:~Y.IS5Uu ) 60  ̑H##:D)pPzH (A`P` f* [?<{uFVN- <(ytԦqpAР , b+@@Lp[S܈ ,1b ]zmfL ݣK@P`#yw`!XZaEI -"%K\h!z c<>> }=zbc@@ , ̘:g:gm+Q`i]A:((HJsi̖CIqQdP`awD&SsCãcRʠE…E$򀀞 Sg,疗^%MJu\ݬ9iEk{bw)B=UAZP` } \xsˍg7@z ?^۵ۛ҇VVct@k08b:R50r=[:'J@@%@$EEmc [;~lٴlm5h7%s⿒((  Z?qZy믄 c'i,Xu:O_?nһmͧkNvkӗ 0  VG%@&a@@t3;챦BdiZ5E/^Zd~sE?8:|YIW3#@Prrů^⍸>OBJJ}-}أO>t2q/y؇]Ζ>Oi]CT_W !OD 682'Ȏ aQ_' X|fΜir\#p"vh6nFWyETn\x4)9:lNү^x;?/s[Mof dwR`N]\ef]Iƶ i|W!f(}8Yt<1_ι75ƕ.W0e~t^o#\橺D ,>Jh=!IGi)Lդyl9҃N`Ye=*;fx3Su%$X|z+{<ޝK' BO&~rms7O7V-D"B `(CtU >,=̅a"1atـah@z K&)@@57R\aRmfznӹԨ/ZCP`a_a v~-t tòE5nذ - m Ҧ.aW?u2]sh@ ,qOԋSW GG $ZjSpޥgAA~~냃#󋹷* tt\[Y[cbIhپ*[JI1 \ 3_b&yC\b{8 ҇ =Ν{O?&.nZ`ŧ(MrܿLh'l}mٻƒطh0O{퉠g@υ[cMжmTng"@[`D.Cnnw-:ikkjՠ>}6o6v>vpKac%)"p?M *|7ؕp@) c\gim`.vT:["ZѴYJ6Wji666 ر꺐K$7´[dm9hPػ_Dݹ7O,srV\lSZj5`@?)/79F,/,!!#oږmrELLj@@kߚO'%'gѶmPs7.deuKJ}|:p4blˆ*503+hDzEJɈ%8F΍VMmpqc)۞=ޣG'5^|ﲯ qoz͟(GW^Iײf54ߜ:,LMh+O?U㦃^Z5H/]zkʔ;~Wxw֬́[io{JvGnML_\ ːzj6d#㒧ORoZ 5œٍ͛'$%|3[>ɥvuq9O{ eQV֘BJ~̣Yݼ9F[s,644SGvFMd2ٷOdGwٷGܯ{`˗_vE4䦀ۅHO*u73+dfy~q{ѣfIq-r=Plڵ9fymk֌1׏ Hv|{gUٿq;w>zص+&f/\Pb[= zY3;6lt$ʪM"PUEرw R|˖~Mo v u6}u{G3m&S~qbƌkTF~XuTkj9d*jnK U>3 hD*$l Ԁdrb4"~͵T`q*ȹيm.-[ޖ-$¡Ce+`hSZFV\Asگ~^:qDf5svlbmZM1NH(g:{։ƆNN.6\źݑ[Z+?؁5ǢhwZx zS@dRc?^? edM~ȵW_=O!lWyQKCn ?]X~̰ X܎@攚: Ę?wLѣ>ZaW:\_800hP,X5]S !*+I&SuEǎᮋWs;AҊXu%0u3($ @@*=##FDąTUqvv;QIrщB։JkC@TkNY l@b[`͙sRNYȑ潠<{B[u,9EūѹE곹x}٩IayoG-;wFfGSweb8I&f#r!&B>ֆ϶5RH͖|xbP8| e?X@5{G?-:u;:ٳoR?&$LOL~jt.]qB@#=;:]t)喹wι;ǜX֙mlN 0u5#0h量z3ԢOlJZ}OK  &˲/zd.ڟ_v!CdC9 B@-(k@@מ^ V]ݬkdžum.k۬enhAu%E| ӉEZb(1-ݓm:_q4%´l;vݨ L&@Qefi⻉O_{k]N˄[ թ;̴O>.{J-zH0A] fXb=.0oŠt:[ܙBؗ[Z_i|\y.O'[-(ɪU-Zo^l, (@Is\6hut:[Tr*n?RKӖElsRR:'iڑh @ (1>wO2K8KCJ/I瓒-VY٥+W| BW=w &8:7甏+@~q h2~KZ-'ΟХwK_N{fEߋi]k8ykܭ,U=0_ ^X;DSʊS?%%  7㡷[Mf7!+Z6i HVcX Vsᦱ7v[o I&;}>-%ũ\O~`ZjI' Fwsw }>CE-g|μhb&}z7M5{jC @ePmXmЯt|_u7m.hṃEԘ!O֚>GOW3WBD ,ذP+K}VӥT ;n?lly]wNcV3 t,-?wJӋ ,`qѢs|gZgogK˥AA~~JV<(꣇m$@1sO'}ЯWG-:B  2q$<#<607/Xde}BU=l+ J|"}oiҚsѽ= "b@ 'pHz(!8>JQ>1m`^:F 0  TUKw56tFI3p2u*R>mHIwWiZ"=XHҐal@С伄[M3)u ,]jc,M l|q1Ѥ̔L}g\fɑ [G%E̴0e4qJ:|EX{+4 i`?:h uXm^Ko?u!AvD Ҋ>^VL͹ug"\9 V`FI*sZ>3}+3W 7>8[d vmmitsϙ@ 9n e,KO؟Z?i"d0( hEVX vDhn|mڬcK]L2)A)_> =@ڰ)9dѳ3 + 0ؙ;~PC쇰CUnoش0: @@X*`iE-f|:fKjk]eUh@X1Ba\(O|.vJd CX:Mwe|pRBK}OAn1Ms+LJYwtf6yu @@%vMG;v ]X5K+KƲ|;[u6đ) @ ,T,Xn}F=c<;lD7ePSl@X2ʣlFv1?XK/wJ-K;7eb/wsw]q @B@%YZLũw_OǫQmc=P[[~Ch#@P`\4?rΤG5._b=Uf7ĸ>M˰GtfD$ hGv\Ek|Q| dž${vP4=yꝩ 7no\[bVb&ڼ8 @@(4)꾞V<64yN E sUkZ|ub&AE%9G -XڒQYq~cU" }$»ir@th:^5͜E B X2c蓀TWc;u=47ϟ'v  @@(=?nW懛Ul2;O3 Jn?e=Il @*Kf"ewՏ'}-<=Vc7Y)k^ @P`\^(Sb\RPZL|)my: Pm$3{'`Ǧ8Ήi]IO*zq  UP`%} q^W֍2B  ,Omy偿gy}kP+%F' @@%ک32[|79}Îo¥p~" C/K|sX^Y޼{&x9D CHh&34#Z;1W:hl9ͺjB4 P@ T&edK&%ő   ,qܴe2Xg9=q+q# V` wզ᲎R鳠?[eeCD::LHxȭL S>fB [& KoXϖ*nwܛƲ񅇟 l7-0cS[ӦEyy9?&4tofLX\ә?q˅=<dv1~&=;;ת˺@"\Ʈ @8$=VU{8F.Jm~YY-fYEE {G-SH W/#-rՅE6-iziA\[Rl1޴YJVRNv'K8" `/NK gYlݤ'M/7횫m"T=4dXee89ɟ@Dƺ( K9$(r2uY:-=##)OIXg^  GDV!v!:\[g9cU:^E^ٲ@JgGx>޳gcXg^ 8k7 >)'5o=}kNfN{3M*t=F @)B提 @P`igΜa]KҠ ??{*\yooo5#SՂ MMMkD4邾$PϽ4&&vrQGQPPTHs?KTKOVGߊm?LT ! aS'Ol߾=K?\bXr̙3lѢEbb"5HNNvrr)+##ʪ6a22빗v5**~Yfa/5̽HYKTKO6f~+п`+..a)t1==^dffvI{QAk (5SR`<Rkk뒒꿬b/C6j Թ*䗞]4aC(c_~̘1k*w{{{*\yWWVZܾ}fd z[i I@gϞGdd$i8VKT;)ߥZB`zNtjժŻK'޽KΘ1CKlٲi&LN☘-!{=!Kê ݽ{3^AzEWV)YyQFQ#Gk׮]_]L@4 ,PNs8qI&k{YܡK&YWzJ^s(4gidD6l ~Ãt2I'VBB!pe۶m;F-=A/~~rMV5Po+MB/ s/ɡex j/Ud_VTo+#t QͧgtEWˁ_zǏQ<Xd4#@ СV8E @P`5= @@_P`"/@LVc`@U, @P`5= @@_P`"/@LV;wҥKݿ;{X[[9*\go5BZtڝhp><ؘX|ymsMgKS_i0r9z  \*jb'B9rI&LPgVJZsCրOHjwƆ|⩳MܚG~DZjĦpr* J@ڮ L?`s^jsttt\zuXm۶1-???:RrERi}W ;Çf`._C;J6|v~ k"Bp%=0 555PHJ+Mx~z*UZ5טǘ^Іt Lz =vlƍo޼^aÆ/r͕'Oj6k#Um~6R{Qاl"F987ɞ={z+$=zʕ+݊b077`<N36&p  +jNQC˞͚5ɡmsQ۷oS5܋^z?x0ݻWvz!\\\XK:tikii3WWWh%U{r+ꢃTRkT 6k !wvOa.ms)T$3gPJo)$uppC\M4UuHIR3޽{  AfBN d"#>>]vlLJ'$$~:@U['Os[[n ,3qgϞUW*}߿wߥs^t QiP4 NIUN3f̠ b)$H>aS'L>  G@?Hm>`[#IbӦMt蚧ÇEZAAA<{ oYk׮q[޽^t[ٷo_r׮]t1[AztRvD333 KymSa.1g5jhTi]pt6lwik󔍟Y&6p 觀>gR{_t.K{-[pA)777:h"[[[^,7]^3zs[C /: LUɝ;wJƋC5[ImvE˅D׼{zz1f)Y,ƬH[ڄN[ IieHH!k(?̙3IoL @] gk[7ӬЇ}>#yÂtm!@5X;5#OJJ WJ @ $#X a!@Є`iB}@  S"@/ @i;M%K hRX[IENDB`* DdL\\j  FA?Picture 2blwZ5~H~n@wZ5~PNG  IHDR,֟sRGBIDATx^ml%}qH*<( U+a `7KS"M%U˛[ u(QS o v+VlĚ5m^/߽gw<{}=g{5ZÙ39s;Lo^uÇ?_Y931@Ƿl~G/| VH~J¿ {>vm>@,cǎ7;{{V{b-Q'?^УE/ @__Ooo'/{ݿ8yu]cbܵ鮻ofSAL m'O~;o;o7xǧu曇m!'#|ĩnڸro>x\x!b@#ss?~>] sz a |+_x嗔د_=_]|vv=T^ĉΝ;w٫N<%Ɩ+ ŋÇ륗oqoV.CAErgN:\sͥ"BZk|GJ}A7@,^}ΉP^NI ɝs(ɽJ@; PB{ ;&!$w@$v*MBH @ H%T4Z_YII{x=Y?hc-EՖ2\vCD!tnZbW-gv=:5??Xҟb\L_zy™%f:å$e@2%)2{GJ&r79U|4“A69G 3r޹R3 P<6qR}ZtH krGɣƨ.[:ZE*"5Wf"a /EHNLB _D8 ܝ(%@rp ;1QKV- $@rwb ="Z@ID!@ ,{XE ݉B @X$h@'@Ha"N$w'& !a /EHNLB _D8 ܝ(s΍@r (k=eAV{aNߍ). @.{.W֣Ee(# gAЋ MAa@ɝ(@ cYk-%dI @YuL(y-"p4@lY{ -#0o߳ghyyGiLF?z&AKrfOݪ/?8u @䮡 ئ̮K@ hfvS/YYxqoʊׁkxqGL*s[gκD= w?55v pjJ) Zrh KF+>DI  ֒+Zt-ZDF<?PѽZ>wO0@Dvrו53vOIa@;?36V3ZяJ m&Ȍ_+;̽.J"x"f0M-DI P)]\ƶ8lzzFP]\\Ұ&!4Gw(61}r9 .;Rafs2 @.; avka j==+SaSS?11p~,7)om8l~~>QHM`Νwoj<ɐ;wntI*]]2Q=+smi2]3̩ ١)uIga~1q*ܹss5ԫtVe-Z!uE6hsLtc ͥYRAElM;<88ic( `$ǤAnh=5tTUc`G@ P;8P#ćeB{-G$ @[/,a@ytt[-@,k=&ff1e_@mzLB)RSh;z@uyW"Ln$Yط`;eRp@.S&KWtn-{n}>bO2q<8c~ϸZtffHsƓh{*eڗmYQ疱yh1=J:Q4={.R?o`s 1kt?>S9gO^Z^^J}+dV۪8Evro!ЌٛӢ7.Sd N}nP'S:yxX'!ͱaw}{"6z @A}zz{"wn>_@D7d1vr}2Rj^L )?Kj YNZw蒮#!@ }lkMWf#! &'IGG@h[>}{f51]{s'-M{prh3F4>>of*qqw+?K҃~KQ dǀ{!gqtQ*k{0%8e|x}MZ3C&;s-CڷݣM5 {mKp4U̥Aw7>qXY!CϨv}OU#> Ir/>鐂oiI!Cۏ WUy!@~dgB&whL -x(ǞvJ!}qiͮHW3ϡe84CI~k]x! ŘgiE?CI]aOtеit連'iE?jc(z(5p-i~ձ ,PsPpKL=>JLht[#ƿ4??'%ursP5K5wOqS4(]:xmN^% Dtپq^)8ӵnKLr7`8Ɠ}զ(ֹoQs;@rH.d~[f|jev ږqx2cC(稭KjTej^'5 h3@q3 5*vG&sr}4jA{@\rND% ֒zShY%|-`G@#\|3d-ht[ ZrQͽ7~C$d  %wlM/c.k#NO3&BQNf>3,{J 5pc0-Za_N@ D6GM!(1#hcV&!7-P51ڋ &6_DJ/y2o( @ ;?GvH-Z)* w n9 (H-ZOTwX-aV֚KTu ܛK!u!"vr3T U@2ĐA7@j <;>1.ls΍x4C2 =3;w;BQ )nԔz*r7z5OVZvrWf׬Q5L?ULIF/ƙ @vrWf4MҊފy!KLcZf 'U$ P>;k0%t=Cf U8|L@e]2K5Qh5 @egjES̈́BG*(f*VgMF8LaZKTTG`-[Z4>:Oi 9h)I`-qvM晹JZK[@<۫kkԨuh*^{!\;}f~~>^fl~5th[TF|JGQLz3&O&,.[Z[bB3O 60W75_@s# CSbHy 1j&H+Fc(X]ǂk#P˘u@gk#XKI37tc @X2ɘ!w7- ֒J##4/rr A %2??V yTS ~$%3jj@ hp;@@J(@r/a$@9P^NI ɝs(ɽJ@; PB{ ;&!$w@$v*MBzEZ_YɇQ^bEJFZpPsx=;w )s`ݼ!mހQMzSSy&wxNz--1}aaqrKFj57%/E+ԥ:7f^JG{2Cqi2KI zf2{Ԇ?*i}:@ݤ왽mr@y&\.K/N@L (77j\l[ %Ff˖r:@y&NJ $wG(!! C-bEHPCB [Ċ8 ($@rp ;BQ IRo+ (@rw ="V@QE1@ ${HE b @H$zX@G#@H!"$wG(!! C-bEHPCB [Ċ8 ($@rp ;BQ IRo+ (@rw @oW$|= (x%4{ԈS7鞞;ɽ,7o r<:51@c7W ΍ffK :r)5'wf8z={5̨*Eq4.X/ozzR/ WԬ3{fwǶAvp'};ܓ-ʤ;{ŏ  ]SDC{E18!@0m1_J3mC^kǛ[5<n{rnO1g+LrwNh.MHJM+fǎr9V̘759mz;"tX(qcn06n;] 0 ^[+Z⌄۞qz'O N #+3o{w&J F"|N[HџH.鹌Ysl$_oZvK帑oi!{^){>q9R&5cB~Y݋~R<6ѕNe`W4qN{\4J:K}Ш)u/֕%pdvPlS^ZvJ/P|LeK|67pk+A>)Or4"r@ w{Tt_> @ w{Tt_> @ w{T诀MwwC?s_|R%EaR Sӱc3YB?x,Gg_HP+vdyݹCX7B,Z.2nn&?zt)^$L4#|{}H (kQF%we}wMLL_G]uk}꩚UDH eɽTrUs5R]m_ÏfZf6FM dɽ^&&2 ثiC3,]kG_ k -뽴FaFgϽClhZX}w||R[;p#!x^x+Pܽ&0@^@B`X&"N@ =E@PHq" H ("@rH @rOEQ@ {(=E @{,"C)D`QEz(' &r˭ŋB]`eev;9~5&? {{UW)g/Ǐ  @v)%zȑ/^UďTY>wM[xB@~ÃgΜ޻O{jy0? PAgggs)%ƭ~4߽_ٳg+B@@t̳:JJjHݴOVnݲxM_۶}s=6 Pn;zhĉ gΜkLג~8}zV{qO{{ ˯ .;?jO=nj?_Y931?!@H`d-[߻/~ 7X2-ž-*b-IENDB`Dd !x#  c 4AChart 1#" ÷ PK!^[Content_Types].xmlj0DжXr(΢Nm)A}dB3gfb= b]g" sM g3 ~a>@FjoS Rn*>G]c#Հ%p)K/ vؗCYHQW^ W!VBa1uiUդzUo t@\v:[KMjG^Lgx8qo:M'H95ƶ xp}s;ؼ"7 Tr/PK!8! _rels/.relsj0 }qN/k؊c[F232zQLZ%R6zPT]( LJ[ۑ̱j,Z˫fLV:*f"N.]m@= 7LuP[i?T;GI4Ew=}3b9`5YCƵkρؖ9#ۄo~e?zrPK!7drs/downrev.xmlLN0DHH\[Dچ8D*Hzh w'^{b |}M/hF3o` ;`[G# rZny?"#UR펴6,O&.W ZGCާ Q5׽:rkD[R\hTEvo%z^CQ~Hy{3}N .!EEM.ăק5R1:S$_T`mQ4:b%X9j͝4aYLQ>UJ>h8 }u4+='vR??'[_/T(U h׏ 4-v<{170DYcEupUX;){3O9y,=N9j ! ?Ov׵gPK!F"drs/_rels/e2oDoc.xml.rels 0nz&ЫXIFooЋqvov1ONGgYqh{كYRC׫La,Ų!F@3r++L۪d[ᕭ{9C/ϋ{rY}b-*>2\ _n)WR0LMQЋgD' k5ͅˇˊl3>GS 棔|˗JTs&~rz^;$ٜ9bӑ .bCeBI}p|a&0Q"WNK7a$qxiLST1~~W@8ﷇ-U["%0;LҪS,ô$%՞k얥E+Ғ)`3>Z@Cה7* ??s%-8Ν8ayQj+4^)_ߣmc(,|ֲV6Є%wGaF}qK,.ُ$5C4 w1ho3ak8d CkG*/ E <oMx8s )T#ߒ -J= dؒ}))33Hl)p_1&}[3%7T!pz?oO)(~bwZqD$El5Ld&3DD[VPH,J^BpԒz?v5.Qo-K|/؊[kJԂ';^x#R1~Zmj2YXfHp<0Wcv29ӓJb>h#+>-wU&;V܁N4y\ϲ>7ٽ 4"l#"jW5 „&ĠA4!qcB ķ 7EtbhV_ ]##Ns;{4B4S|di\E{evh/G34)~}ul"CX1 Ē2FƈNs5C–0 PRݎn6*tcUލ&Wr7F\mtUucU5ՍfWEK7F]Uݘ6-C2@ju'64ii l醜H.&ܗj9-~ cM 5Ѷٝ"VV;>DwCy}k3Vi؊翊;%=nj"r8r4kG.庩)a!PK-!^[Content_Types].xmlPK-!8! M_rels/.relsPK-!7Ldrs/downrev.xmlPK-!u 4Xdrs/e2oDoc.xmlPK-!F"drs/_rels/e2oDoc.xml.relsPK-!\0 drs/charts/_rels/chart1.xml.relsPK-!.˫Wdrs/charts/chart1.xmlPK bJ7]5"&9n7]5"PNG  IHDR sRGBgAMA a cHRMz&u0`:pQ< pHYs&?vIDATx^kř |qǎ8'8'Lnvcxߙ=3hf[6cs$HBԴԺZ-u޺EwZ !X`ac`OYYVUEhi_Uz| ٳgϹg̓HHHHHHVzxI F|@́b0A$@$@$@$@$@$Pi")+= $@1A$@$@$@$@$@MHb ]&     A     hBM82 P r @lAgIHHHHHbsHHHHH`:L$@$@$@$@$@$@$@$@$@$@$Є(pe           &$@1؄. 4!&tvHHHHH(9HHHHH ϟϡVVIP cɚHHHH LGW _BCюw}7tլ"(+2 ^cǎMD5a„iT`wwwh 0    <"Ξ=kkVQSLIm+x"`gvR fdzIHHHJ@@;jyY[A4ftY-N6"(+2 A4qL?VݱcjbRN!iϕMm6:b%Sxh~Υ @1^ @SP XA` `YĿ҈Tg.犋m}x!m_rmCSO&<` 8K$@$@$@H@?D) ރIL,vA4'\ETч:E$Hrwf#gfuH*B'D|En $A*8ݭAxĠzY7Vս*uߢ)1,ـ$@$L$Gnכbf5+ H.Eζ‡u  KQ5CsMn&+X uߢK9`s3{I$@"' 7\" } smjXȅI 6`IN\B!eߠi1Q*ϔח5#krVZ(6HH@Y¿q4[Bd-+ TMSI~>W7Qsqc44눇gq|YS}cHJC@B:H'$, 6H 7}qbW$1XNYZl.jZ'}ڀzLAor$V\wuG Ht+~z“q})זzG%rAYK6KN?/ԩ'AsXԠ69ԇxŸfmYuOeg[o"@1yA$@$PL\!)TeіkK,.+ H6*L^.Q{=zĠXT61("L2z[mj{}HY/$FTSwb' b+VbДY.ƉAɤ]seH닾/9 A] L;[Jk+ֹ$Q7߶$IX)1 T@1>@rr .rUbʱ%"}_ n)KtM5LWY1&(2J$@'F y|Šμ\|^ ̙3g8iҤB5dL?Co {5(?! @=.b.M|`͆@I (Z[[K̈́'~5Ь(uo ( &F5Ӷ% rpI'71cԄ C_ @Xay6  <`xOS 2/WA$ #"` " Ob0$8)+À::"&ꫯF]vY"of{ˮ@c P 6?N$@$` BdI QUnꕗKLWaD=}C_ڄv++cckJQsm灅+eN'@1X!bIH jT\"^%0&!bfĠw; Oy@C 'LMIsj<.s{zzSG7)RGuAZ*+)i܄}<HLy: n3jMb3^%hʈN,,lA^r{7>ϓu1ˣ  G A$P*>M ~T(7 Wr(H OZWZ6<BW^.A*9Ob>߲XSQ,q3͚G~պldܗc'N;.~ s m &ŵ!_^?.yTalOZ֬Aҿ3>bP/|/*~'rجK>Ve+2Ab}sX1oԋԚj{ϥ4UI"1I')TL)R59 @ #`؍ڃ}1{ׇF%L n]n@L=hl /m 5 ;iՓ@H iͥG ȋM,uP~jb^bе4+XC8'Xoo7MߊxRE|+_NQN1i8:n!`g~1۔ˉC6nH)' Š;2tXɲ]462+J!zgrAĵ| &19I 4fMs eErMXI4?ʩ.hOU /ׄ_!|}>eY0i29\Šm!w䲸r{0䆿\&5˓Itwt3b_XԺ ME$6"6A5U, Ibf-"R]Z?ҌMkx)2!8f̘JtC2>E[~ZӬyNCĠN0 Y-꒐F YPy B{[U1ɓv=TŵԴWuK)j]E $PO6r|Ġ,5eF Īx%AҌ<yU/뫯q^ {CotCIbPdw_(k3ZӬ}NC ˦[G-4 rawqͤH-.T#Iזt6Zb0 3+8wF_k_1hgm7QPԺ|ƐeI V%▵TjKO`|O]7҈A9(AeNJ-FXwĠ}/J1X_.5 2ݼX/ͯt#VdAQ7&b03t$aCh ''_ |Nø~CA׹!L4OSN20eSϕt(*QO]\AtRFS"6Q(S=GNAr\U +DZ:R .UV/qal/eF#u|:+תQB5mIZ<BAˡcoanR\]왮gZm3;u(nL:$3] J' MZ) [Pdŏ)P\OrUF¼Š_r#2ϒyuVK.-m.qWL% B]6('Vc9J!*>ĉAbtO~⶜/8Iߺ5=p$ۭ>@вJ {6א(5J8rmN&.MiѴ2?l?xl?&P5&=$3|=d?^\^%XijIjQ {m\;Ks44Od̊ZW1$KnD̨R\I]Q/uAL;ep2jqm;%Yr}LlnrbaP䲯jte,%p4J =Xy5xJ!MNĞ*LͶQ*bS}B 퉲I(C$C3sR&k~dz"kOXb `=?=ܕ[\9/ %Č*_wuxMCs:(^":W1!;gΜ\4iRD-\s-QWJԃ+*:"i0BAy?xOWRy(tæ@Aw?7YLpMS$tmjR}y0sZAS2 .,.}q-Da҂Z? Š\ir>7]tdIf#c"M7>EhsUڀ6~ʥ0SSVrYVpyM1XoTQ 1zb rIK=BOOA4%7.Mϥ}%1˫d3EoLYy}pb3i^zAW eP1OOHY\c$̋Zl$!(Blk5@V1(ך%Zf{qGH.σH.t$ִ7&LFMkV^GtD;B2smk$*gƸ1;W7nO`hwP[{|-47uFBuT@Pu]5"mEq'7pAe#:_g @ *# W{ ~5~&|7qJ*0BA=!ڤ[[m3ѳ=IKկ\MIZu1gUֿ&q"mۀet7HO L߄gBL&XifVP `ٓYghZ_Zz$wXtĘɾ+j]iH o-1\׭yE` P4l'J]y$Pfe=Hn|DM7{"ԛok%.De +R',#!Ś/y |^ tYڗ->.>emDXAY3-@F"`L"ؚaasMny^K$@1H6 @iASLunPL7^ڢ"ED,=ꁀD+MD Mҁy/0&-uI\,ܷEl4B Ç^x!ix|nsl b0P ࠲K$@ 7&nPS+j&V6'pAyB&E ,euZSC cAXw1/qu.5G Ĵ>[ BI"z+bB=zcrC,ö`Fm!(,_1(qčj'7"j 7p#וS B1گPM ܬ3BƜT?*賸Gu&Ӿ,uljA|&I9'QAZyXsCsGᢧ bЇ6fmH 5_1h[&F͔ԍ.7IB0:bj;n:/lrmrUZ:mױ}|`}/*C*taאA0$ 遁6DpVC2`gWK]M١US`'/i7Yr\$d0K}G)uڹUJv"K\lOMӅQ KKwM9EXN}K?Ӗ2Xt1GhOmN X"Mb4Y6y4:lc$cjO =.&0bPC`f[tr!x*``4v>"m<]sokr,5n0](|ڞ5rOh:\d;ygI$} "7,AQ&L\@ a>wJz3*ׂSϑee9A|: #7|qLE]p!4K N6vțuWH25G fq.4=.Y (syF YS{~X']b.҉A]D% "*ܰxar'bNn(՛:u3MJ\q?xw6=1c[n3h S$YNcRĨ)D4e|,XtdVh*߸oD+)De8AsqbPw]f1-t71cԄ C_чi[W 'YM{)=#x2($D)pjYCOnL.Z )B_sE%n`hw7~ӓRTX+ִQ :U's'-2gcidM mL?2Má\#/1(Bi,Ld+&Oׇ b0E8I7 pIJ 6G&NZ\܌=&7T|F14b>'P*1(Crw"NiCE zo+uY|P\USs]>ks^8Wwe{|v=SAN;"8eHk[^bPBZ12TۊX5A]`H\MeG.Ҳ>GJ;5/0Z~J5f!w ڇL4wr&{Ġ1#)pL^II#IbPȂ"?:IOP^NGczI9qĢ#Ái,b7誟m7&8Ag;WBqn.bc,7n/ `~ `:lNUiW>7˼bNj<5݀fbyΖ'N Ġ+bxX mɫ՝ꁁG.o>p{u }K8@ԃwꈤ/Y-qb\Dt(s( XZ Ymb/4CȲ_NqY<]D27s>_=G73>XXS]ӏ?~sUj*_7e0 ,9?LЙD7ԍypg'7(䑓=څQKY`t7[(3:bܸq I*N JLy@7vnƺQoe8?'2(YY"MM2֫Cڒ^"H-\1*,l_UYhi#Bi驡MKCjue0"̝2.ls9I ~+_5q޸* yT,. ,XznǪ׌!N }tq7.*sB(BJW-Tņ\ fuTAer;I\Ǵf9Wu%MU/I&窛Goys,su  sVPG^A/?2ʴV8}|E.2'! |\m%U|ru3Y%qqm$@)`(sot3km.ƬgBIK |$b1S-{3:/qSy[͸9!OS)⪜+bb0E#P&1X ;a[O|*Չ=2;IqwKn}B*g@)ĠXL7徭ζ&ID"B鉳FɴLG^b&S\EUn<:@Ҟqgy%[ܫc\b f#/`^J%@Q f $ϴٚ,o#P 1$BgI"v=ODsn IrL+էI t!izvB%6K͕e'c+v "e<`=ƿbbgr?\0Cy6ܣ^u%%9-K1)fq7Η"k‹A5$W8I% |u$5\t_LIa]GbRef9e8+L|PW5}Z.bЖN!gy2$@"+1hUY /4,W$@$PdJMV eǔ )g夿js\y]Ώ+ZU&yR sN@h>} ~reȣ0CraI&Px1 9c+#X6| QQ"i$ L5mbIumr$LruV%p>1h,b0﹓en&ZGu[[[kb'yHtM!X>l1 BA5FRԲ$ˆꆨ^GM.uRIh*lAkͺ(rn{ͺhy.PƔ5Ǥ ):*RK$=(gy9r$`":eCb>Q/qHȣeSR`~I&o~:'LcиE},LWxe;.seH 2ABep5Q ,#'pMܪE]:l"rwZxi7tByXa^yDd<膯E# ,E|xƬH@aŠ-c\ԛ]R᠋_nM7jL©U.lTVIbviJ.7I7Ei΅0b3k^A)Hm8L/Ne7n^i.)V֤gi_Ҽ[X|_ P  ,Lh3D`3@a`^q#bsT+8#7Ǯ%ԥ?Ӝ}A}wiڅsն3o9'i`δQzH=YkByA7gΜMQGޑJ7+|Wk911`E$@$PM']Fa7ϵ ,h\6qA@AX}W\!CQ%+iƏ_J*\K67cյ,rxea_ڮK5<*Lb2jb[jLF1X!Lyv 1&w4b0Ф>)C B<ڈ'M!O̗n'6Ӂ{)ٟUSt/)^yx}esLǾ6qVI%3,ei9`z<7~<`}HChs* yՌy E%¨){=蛬b5{x5rGf2[[u #Gz a(LN,662OUyݨ1u͘RDX.|Jy8 M}b-d೪|؏(=!`GsY4t5H+q M  ,},qqe; !a]Wc;:އWa؇%@1ؼcϞ@SH9H^m* -B[ BO.AJxGcui>x A5tq̧=W:0G$P#\nԨ8G$eJ',Mg1}t\ )އ`qeJ[`h˥]qoZcfXf1g̙ӘF>y3)L$`H }\rRb(`YKoɷ(2*.>,X˞/~AT&1>1 W9+ c іG2PbP\K=um5)Ǎ%`s3{I$pX$E )'H2 /i版CՀ Hh5zQ&x|)I lup!BC`ˣ~:c_y=)²kYYd=y&|Y;P-#L9$ (aG aA&G$7*>u-bՔ6C/q5걽|ۤ$QH^1JT^$#R(#c8 sMr'&}v5 OY\M)ߠVazW$l ԛ`z$@!ah(LermBpE rYzӦM C z'NZe!' 0\+:l?~'Al˲zYj'{C$@!PwfbA4K@ !|[v9ٙ(2"F$@%' n!{pӞm@#E١]־S/dyᢰ|R]B1`!A$Pm_HJ@YǪ b0tIYz~S0y8z^3p9b~18;?$,$@$P`( !m7Ͳ^ꦩIB[uKyy[u hƀ!Fl$@$Paba˺"!oy.2E`aE;#, q{( U@'A$|(oc #A/ ΐ7ْ0Q*.Rx@#{!Rk"7zHHHDQhqLZ t*줿n6J&cUM <\U)Ib^ @a WG`TCcf A$XǾӪ4ĜUU!@1WJ$@$g$A u Yg5^s,*7? lh$P'HJK ^zؓB )|*U ˻3{ 8f(2"F$@ B #b0Hk#,[<@၁גM9A$@.(]( @j&!Z7GhwՅ=}@Բs/^H 3HHL @KB#=¾G^{-C^u@`#"=lQU~Gqez^H  @H.? { ?!ŠDamVX`UΚB$Is.<\e v<H(=>l Tt1Q#XA]Hy+?c]XZ!r @<=e΁Xl' A?^,M$@$gJ|53R $5$*1gΜhfb  ",⨰M$@$PQyD, 嶊) .5A-"ֵUb~%\&Ls}% g @Q4` e )ʈ}r?Se!y-.n²ml~ $@1A$@#p(lsBG 3 CEJ ;&0wWJSK HE"@1X`[H#o]!ڋJ^/^465TN(Ԇ$E-vU}ējY*a2 YZ6^_ҶS=Oz.뛬sT/Ε ,qϠkCAqxDTe15$+— a] A>y&/6qzIkdSUQo鷾6bMΉG 킜e#@1X1cIb͌˓T0M-?ںGYDZ' {Qzm}OO#uOuT'" @_XkBYڕ5̱kˣ_C}ڛgGhkrĠ:䳾\G]T+kZ/;9䁑< _'I@5bM6qfZKE$2 wu`LJ#$sCo"`TQ!?>4KWbi "7es:=QՊA5AܞK5hX[՛>}j`n⚙3wXpYEf*߮)g`V_~ƉAug}uL"m.\`>"rd]X{dkbi@f [܈4%'$I9 @d z$HYS9 5f3@% 1܈heyW[(*dZIaX=V(V/X,jtyqDjEuY_PV,*7y8u>}=hV՚v& ۚT#.k_|;$@A JO!HL9N: d4)V? ōb0ӴAoWts;T=e6Du,=Zi?;goĠ/Tg}uK_cE4Ƀk{Mtƿ\bPRy$`j<H| )(2EȵN5: J!fr+Azzkp.2(b0Kr"{PI3&rXja҆Rs?Ytfmz LAq+ǚTWOyxnkTfձURYwE.Z7 9Uf>#@1A$P)^Cjz&̵Nۓ_]L3YĠ%o1]CMiڠUo#Dzԃ}Yᓵ,mz.XIP'k{30MXdGy/q,MqL\<LbQk"&Vzpt\|#C.(]( @iyM{P1v ֩`y_uMK$U^!'榛$4],_iPT1(7pr,4\Ep9]ڤ*}[Y%g-՛CkgfD[lu&E`NI -x @a A!E5 EMԵN၀¿YtSnޒ\.Uw-0R]T>))ӈ蓔7- La2hMҟF܌сp\30<*}w˔Zeߢԋԋ$? ns$&$KZw$1$i-<'+y> @! BD`q2Z'ڠOI7Q:FŶEn\=]P-0۾/y:#h#;2DD};!d9$jQn&"6Xdag:9%Y_PQ5ګGwezURiu0]Qk!mFIA=zy3HMUeWOQȤi# P E @"BDڀi,$gb1(Ҵ?9"ZQ1˸\ ț`ބY? 7w}7:ye<D/FgϞ_\\.nQkԄϳE=~/pWMs\nB^¨9V\p1 r=`}ƅeIH^(E!p&0o޼ؔ)SjD;v `_]DB$cǎG@N,\]YT/!XfV eD`8լG=sb%B"HOi  P(Cd=$@T] ~ƉA)]-y0fSxb/ՒhS% ӸA"Z Rp@Lb\.g@=>5MD!Dː 4fmJBbPX,p-qPeuQ!MBZ:E (*1c$2~ԗU bLX< $&a)3Rр',ȓn Eb0IC$M Bg"?bBy̴ѷN쯓:! ''q-;MȘz"(3vMp,bJA=F~9kj X!OwMfɧ.YϜ)8"PL,Sgmpa2$@P fdzIr `Fhz) 9IY]XeShF#N  LcD鮤&Cj .ib .}x=`B ʬ*Z+#ĒMyOAdI^`UW\ y^|A?<$5b̧ ,}v+[>A o@^a9("@$0I Dɒ%71ީQ].}Tr-S!!V zc$t#"Zo#!l`{pwD.͑U J04(3\V<qa5.{y w@_yؚo#G6ȃK\nB}ᡎvrː@P i4 =&$71T Oԙ$\3N M x&_B*}Lj.rT_uM{SUL%)U(.2Y۟E U5fb LᇽzyX9RiX[$ ||X"ӵ|h? k/\r$P$E H V 7xnEwM☶$2.bPGBʙ\C#{+/qmePWY,IY]s1FH4JĺA8}p<;TփCׂT9G3q{d7>B,DEhp'k@^y%< P Iu "`mx.&$1$y=j}y8ԯw M@ULD҆7#NNtk'ފ9}덞/8w,z_^E Bc $np+uL:J:=QD@4t-#"7qOK@1n s9_ j+iچ@\r=%%8+k)%횦0N?'Flu^H I !ĹtnY,L$$QBXU GGowы?MM;z%zvKѣˏGmz:xtjבGgzziUtkseooR~Nqrυ`a`*y&\CwȦ Ry [(+'YXTaAj&^\K}_t ąQ\˗M &s.dŽk /߾< `QF &`g17<=7驯oAzw"hrS?Hyҗ,b$ *Q=~k -Z*l"PowjQ ^gc[o#b*t0g$x vV:X4y( | .>.Qմ.`C"jlk*qw|le҃9XDE  ˓@QP e$hrQ^bN\ %D3WȷN1O핗bN"JyS! d!7:'ԁRKRoEs>7z}opW}m&nK%! {ڣO}&_@Xe&54YP۴e|;]XA9_wf{_ .\& 6q)aX2vI\2$PDE8E ?qAǢ6:]Ġm߉ EiWB]qo6Hqss gG~껱Osۏe 9$ܳw(1õKDv^ygbwJoi=g a蜁i"Ч">=@,vU&,&mVK/"E?s^m߾< 4` 4v*FV7jr=\$$)+c7u)SL$oL0BR>ܧNE?Wt)1wyG^6'ܾ8\`w4}j /,zPv]z@n 3u"sy[ba73ӯܰ],mY)=ݦ558ʼn/2jdL)}GLbsT1dq0-Vy'eMF~do*ȰÏ=eڨRpMLĊ@# n+3};VÁODH-Zrm&1xj@1qw.H%}aK>P*z@ 3PHo#i%5Ϡ^-ɢeZòV \ޘLnh p'[D{α~ȃŠ'UYilnE\}ORX"(eOX4tq=̻$JCsxoPG.H-6TԂK#詅O 8:?esǣĠ*M4S@5tҤIATr~ зHT50m?/ERF@<{<`P%DӊAMqīkp|h=n}=xع,OE @19 j4,[v%eU ,XtGEXXt5Ѭj%CV8Dmb\~}yG'FU #TiB"D75+!a5$,pqYE #),}I~*7!,N޺hף :[Mb}; L-{Lm<Қ2xfCkj1g7\qYꮤ?:+92g BXM9Dq֊uDR {-&~KM>L}z7)ToRpq]@}5}9$CbЇ֟ #YԐbbM"M_M.'i+),'.2*UH,NYsؿD$uQR=Ӌemu}=D"ڵlj1A裍k?sCg@@Wą{E;=0-CҤ~fUqc۫Ebs\_R:XU^=Vǖ}+A2Zb-tAH)h d4F+),Ƞ裋KOYAI$`>n==~wGM2零7<ޙ2E v,RBwtۃbP'uQɇT_X)kQJ܈eVy`X 8t5T=T6uKwuy$0)R ,N1_\{$z䖶Q"P5Z/<ԂU'R S],C˽`EtTV>+[F<-nZzgwT&^DzO   a!'e)='2%]f ]A?uP0m+RێC붥 9:ep/]EC{?>bt_F;xjN>y{TpKżgX7 4ŠĉAMT-x_iJĢ(]Šh2֧,]ksx Ȟ8w8A8s`b ;R*XJ <&mJ㩅;zzDO~o$^~`@>DXkʵ%DWK$@$@1I?)<}IIXf2p3E='i`jBZ=|7&E\ˊ6n;G߃+/쟁f,N8#c`$k=ᬃ\qc*Axd꺊CRM+JtK)ÛRAXE߽ވш4Xb k.ce*ܖVL$(4V)M%)G`ڮ!)OY_.b02py&.0qKNA>'PRD ?SY-gI%_J trzvh{Wy;xL-p٩ĠnEׯ:λsI7O{ F2ϷeIHŠ? gZa)'\4e%L բ "Mn` /ir 0? 6+/h;{j"P^-=7G3j*,λSe֣3`bpL%}(|k{?y줄{ XMHGa) hN95 8.$InpE5%(M%mS%w4Xx ŽA  b *,E$P9?],! >z̙[3.,-n;~3.{ғ `A  .ܙEzo`2$ "s.o1r~bp ^b{)/!3Ǥ+t(ƾѷ'!! ~`U “ `M  `{`|V/A֒kٖV/sVxY zïx3C}u LO>m  @c P 6?N$@nEtuLf]A:38eDz'em^b6/1It^b{Z``RNA }K @$@$@ K Npe40޺AŽuAyH{xe{N-VΎ缄B0^A( & B:H$@#@182 GO}&>p pּ7:w^%{ n \%WwO8ߵE/1ÛŠU0MN}Ie @cP 6;J$@>I?!Ea#u+7M"amK;m:֣3`rˎ,kciis L ,EHObyE !{f!g+O "gU^b䆖ˆ[RJ +xDJSu`(D`/ A$@$P'uː Nwމ~[p DM11wgB" L\vojwѧlK l<2* @߀9l^b"1mNA}\IH(1l @w]KXnJ-c z癱^ǝabpbsb^BVox49mB)lcwI IbF T?Өkiw-2 ™3f֟E eܰ|||6/1kLS0>A *t @P aF ͋?J%E?[6M,H==-^bpcbp{MG n;\q*Q1V49C Ǝ ` M&(>^x!:x`4mڴh„ WS'z[t-0lnwfA8?u ;}+-CbkYg1xp@V49_=8equ=Aeޱ$@%@1XޱcIL… 5`W} _0}kͽaR0Gni$H[Gl ,wwq ڳY ,yY */1cLSoܿ.b/O$PYZvH ?&koܸqW\a|"/h̘1s|,zz01WGw.W\I Ut9_8Y 9Y n>,p};;Ax[OFm,} |/hk݄X)ChHF  K;M7T}_}]vYܤI9sDo9'a|02>Z{{'ЙIN3uvg1֒ksLJunD6w 2YFMSp}u\IH pe$@$ꫯĉkB։/ab___.'x)'o=hGLbz;xCng1xaע'ڮCΖ#'V;[;\{eg1;A`?>\Ä ˪2$@$GbЏK kmm8  ]pM{㏣>EP:Od &3m ~ \M tqOqt'wFRJtVAߜ'eO~HHLbSH d\(D9: 8>=.BPaoWFWla`2mIw̖9bgA'ˠ A7`# ›g>z~y- cw5k7. eP^t=ӹ>-> QV Il}ʂ=^{T}/^ =HWdC`CE~xkZKFߟ D0wH3ނ}; t'78Gw}'9HRJ*S"| (%7YƎ={v`A^#43s,e!C?o޼QN2a֍kB6e'reR8>>vȺ/1 T'^v acݢbdn7xn'1{?$>dtM)ABg1j)X}qT_oO$@$bA,BEG ª AW1h:ge=ZYʂ0P;vmmmb}Ĺ&цs>TX.4E sBH`хX ǏwJπ$ǗggkiUP-ycn…SR S6{9ADu'[t G <,} ,>8A8x\%HHFhz1 7 x*enI aA#=Yħ>=}|绦gi[~EoN!&WnZ :xo47mq֟r/\ztѩOr<(E5ۃn?F{/ߜE'hHJ k2 @) P *2rS+W-.Jº!fϠ\yÊ%׆%M2I'] z]0Zڢ֦6AmmLSF1?B:>X`|AW?)ھl}¾I R Y-<3Iv,<2I י*AUΕ6F᧊ZCb {$=蹤g?#'YW==+bGؓOʉ֞ |kAoAxA'1{{<Қh<KN6̀GU'`Y 0h.7 7AM H3Q]*J|Ej݋;:"fTw~ڶcFCx>"daT#X5Y+.]"4MbP4c7Kp.,7a/N]ver)H?:flqGᬄ}yjck[p[ಶD1xfCܵ)9xLNb}KĠU'` \ 8hz1Q AMp[Ddi LĠ)E*~vgI?Eum8݈"=RHxA 1RNZ) >ZHSy$=A%C>}|W}|i8??B B^pOY0\E]v g'1r`bNbp.)%:; AON-EqAZYϡ|,K$@MIŠj34:J6XP$ҧKDFFKIʾIi;ʚo0 %tC*uxKz>IͰ/$w[]u%U+ˢF\"xj)\X6>Q;NbTGWedJ'1j~r/'Z>IX >se:+EN_]a;%;.۝J|be_43Q "쎓E 8Ԟ({'Yv(Ql(]^9{i 77rIH( dQ+qE2&K#`=#Al\ĠX]6`s}njzm{(xWGuN'1Qx봭޻* 6Ay䖶T-^pu'1ls1`G8-Q v{1Q :(?89r >\ԧLH_5W#(A=ʦo1VԉM)$kM($!)L{ M_Ue5뎀+X`C` "e,RV"}: Amt' #wm atU ]탉uD_(wM.)%~w`Ut SY!Hw @y P D J'싓I}" p / .NT\?|UDtMUxoi/tzVi0Y;%MA5NrI>A '"ʣ$*|:{Uan}(3=G'vx ɷ-ѵK~k ܷm[1xDܹ`\`w4}b-LVAU'h]k+[G$8%Eapݯfr:f)bL>GygZS\?_X% c)j}6QGE J$i}|H}|[B\YO##ղgm|Ɔ[ w}ꨳk|h!/1xdD1xrCKڙhS6z['Wޛ(2mGLtqpדbekN4 BF:ޑ #@1[KXq ;`ɕ|NRpc .'4芭?LL^4Yxe |{?}'Z{`RJ=C% AWkNh+$$"j ,D$-0y#(pE;Ecpe *隆ElYeqVKuu%Z?+w_ rѩ$1go|~>ԑ(]9e E+p;$@kJ%`J=\Cõ5@1DOOpFqI߁׸w߁蟦nU B4?sc[*{EE0w{ om8,$ێŊ֣3c-};ZRJl+]9l E$@%@1XܱaH +| K|'.h̘12MG衮A>¾ɏ6Tnp0 o1M[rG]~XKC?>b{/͸O( 45~vC@͙3gx?ߗXa8~^xkg=0A&N댮ZYXA8+V ^7k<271he% c;9uMn{y=`A *,E%%|n~8+:B! "|of?}*wP(=awpM+7M;G W6N/wN-Gb੶c]D7 n9<*S >k+  2,$PbMqEp>~yaBPflqGC-yc '9[n[+\Lb̆X18܆X1RN9/}W{id5e a$@$Pe)JH@!˂]5\ B^pOY s "[{&DX%o2$ٰ#q쎓VA8Xebp@o\4d/3c |cϞ(o[bd܃A & B,q$P|pߌeϗ'?e!Bzhu}퓂Ž^bNb: ebcɾD{DRJ<d U%^ A(yH(>Bl @Q?)~V YQ]ɞr&Ovw|]-sb탱qyOY+>` v/=-b0*Shs Bu^ % B,q$Eϗ'Ri[wUwA-7UtSVAxvYU :f ddyj`RNA&!o>ϥu @P nH ",xעkͳK+ 7?npזlF;;>(J \X*1TU nZiN+̀Uz>U0) foHCb8c4!kx`E9Q?]SQL-ReElqHlf8i61xeU \,-)%<}eQ *h⽤'\p1/H U /Pnpr_W/| חZ'Fs̉<A8(?ccRY 7cK;rv0:DA87 ­VXf18صh<}ID[͖V~v{[r Ăſ1,>,ll) PX1x/÷kR߿?zw}Oeh&Dߘ1c/G!xi__=Dg˿$@$CbK,3cǎM & KADMib@}3N <0%wER8RETF[{&DX(MH3qf<(ww1ZO4={m)%=*SgQ*(BO~QM$ t -w28o{mnA}+^HDb N?>Ne eUq'"Mgwxa[Q$Jjp^^{4.|^X8za w8XTKaU#k-?h|lsw֟%W4ZXm v,%h/4AUЖS+!f"U @ (A=XpĚMF X#uI=>Eue01DEummn+-DW/NE=n/ΗLm>/ !hG{=N .7Bض[b1do]o;sN  Aq={$@GbÂD7In8G\y ~S/7&+I m2M2rQ껟}Fw~wީy0Ns#.ck.XӾPSmQh]awbc s7%v`<2i[VN RA!"Kn[+g*3cG ]cFˠI "sbD%ou{^'X!A8B (T];e*lbM"s[Y '{(n#ů1?0T&J÷MVTa 2 ,6nʈ%?-r )˞Es:&(^FLf]-VAxQbŮ9 2':J\423:hGVA[NA,( ҈A9@:61hr5 &* &E\rsR噟O7ȸIVQ?9q`B&pb0Ay_}x|oRg- O B2`=Xx- z( $A2caG٤S4 }?~zqeLd%I㻟 ۑ}ĉ2nOqUK4X!:oxO,[R]}Š$}^&å/Hڡ>81>ZV,Pq30>ژF lO[a]D. pa~ ɷ-li&ٰøopvQ̓O n=:s\5dGY;Ov>b Ay.<H ITbPnMA&L7bŁHͻrr㊿zpSrS/-qs;R~(S@=r]vYMM6-jmmLN,@46A=Ip>4J*$^,^+v%N b>6ˀ >+bT!d-A[NA,h_K$PTbI0EoGC+ED7LꓛX["_>3 &Du⸈A)sGƍ>ܜnqjUsV VoW cQ`7@L}z4㬊d|a/k #R!Yj!X裳gwG!gwѕ-kuY+ btёDnV+#`-p٣7FASN7=yudK|!_>w!sHH ) %*i^;VM8iO#΁0 u2>-//"ƺ=bՕׇ4bХ/qbPJ \u5=MQe]J;"ZTV]߼:ILKVm%.ka<6z@1l')}E[)/b].r?& Bi`.WlSɭ:`qW D.B BT 8%y/+]1(ԶqTOJp|y6Q]P?XuwG?i{]_<>2# e|v'Aѱjoе{<%Q :2sbkQ.;**h)s‹zIkre$@$Po&nn]#ɣ!%NA&N4,Q> itK`_1G _߫,ˢfow0:: a! |'G kEtNVASNxBAUlUw"l /A_b,K7Y+`M@lhW!gv޼bе/!ĠkZӞ?$>}zysrgSF6;lpNUY5b̖9# q<52Lbp'G\44R 23*h)}߸`nH*AbXNP!,E_T^R4X qFk-{jYK)h>}*"ʌ A(_eTSJfiT^6h*1(Qx봭޻${"-0v_gtyo]?UtS#(1x}j!;"'GASQ= )뒖4~N$@ @1Xa*W#! Ġ¸h(1h&1(bۄ%ݕQD:"I"uõ/Y`RZxKVoX:]7I1).RW7l(>ӟ$|8B3jb#YxAرbĚ #,v}#SJL r r`y D߼WgH (9-r%yWwĸDu*װ\a*ç/i꒙n97m>kM-uat}}]ṱFWw;!m!)vIȫ#,>k4>r A}Ͽ$, `!"| =r _ vQ ?`P裓gm|TV7\a'im%l]0B nGNaܾnd$Q5ļL!zNA,\R2$@$Ph6BZ*gzEG &a1(ўhϽS n1BؾI||}7m!_3B va<|rd%\KCczNAyzeHH( =5O.Q<H AbF $&M ,:V>EqXGQhNGOx¾Im`2S7r=쎓ÂP{N-׌C -bzNA(g~K" &΋ (ZԣuV#H&GYŠ.oZ-_q) c_Ԗ<-oA'>D{Quz6.wta;hX ٻ{X ?30*zUP)}M^XH Lb5:_>J~S~=]F p1g1h{={M)G8doAV !̼} |gd{6!o n>8B n?>gX |I{a13#@{/5 VSB NnĚN 4/JAIm8 lǎEbl\p>DpZ Ş?wlO-uqxmQfyµ0N Xh?:xaaAo6ztܲep"an?ưs r`u*ƢV @J&7L$ 뷵Ek>,J󁧑@ |OSA]-X([HtluMa9CΞ嵏oF]uTPCŠz8cْgŌ[*e9 ) W^7Ib03aT0[GyaAtש ||a1yyI)Q }vM {{(+n~ox6 @c TR 0{\`\Ar# 1o_C`H`OQ?>tMsowG <Ɩ0"/=WDKs{2vt,a9s}'[xtjM[ςǬ\;G5FSl*!Z{(AjӴbFg_+kppkװ<5ÖU?K8ql;*(9Oځb|3HH*%86 HE Jy`(◆u 4@eĠ$O#,Yŀ5bzMa~s2 @<g8OX('DWВDwk6]Kګ>wYr=pR%qy:`Rܥ먩?[ORI1 ,:V>j7*8" 'VE"# ©]EK3J 9f8&;Wv1WP)}+a1\K,# r.wM ԋtܐKܼ4ݨ7tK~qXDIW`ӣU2xRj,+}& ՕXj U}"B'EUl1n򍶋_b_ѳO44+E>{Zӊ;1Vv0za18a18}Ӗ};Nem5jbޚbM znUp8 6>Amtv$@JbQRAn[>GhtfxYmrY1EX "EUOL>';}6.:MeM8]AWW8m?}1]zM}zhަ8iQ[4,faZQp·GX>zÂLؚ lYz NkbpّWkbwVĠX% 6EP]fy 4@%`C j UR"lm80?A]0 //ފЈs}σ`7T$u!ix[ΤY7Bt}S]G|"nM^e(g/ວۢOG{=+8L# (D]ଖaۆFSJ,>x2hἂjNA vҚ原 @! P rXب8"I B@.Md}ȾA:i X>K(..98"Ip&z+{;m׈s-cZy|q`o#ѱ5r+ 1s-FAkFEm}`27lF<~81&奬T Sۀ뇰 bSEͲ>tQE`o]quգY+9`Nbd]TU VžSNt[T3gn=kjOw-skbpQw}gjc`G4 @ P qQ J\\ qb"I.,"'t}/{Wku@hǣËoI{Gf8l!\8&o2е&;> vN?SKG^ [SEW޽bb8kef ,ڈ=$)ߠZj9zbb&|/:2oZDˢBD]gM4&_پ#ڱ}_4}mtCk~}пfDNA}: A A,H$` @1iA!{#]½( $uq85Z1' )DK^nX+&߶<ֆё ]51xjh ܷ֬/>AI eaIy P 6س"wJ˚[H`Š.'<4XTt+3Ymi[w5,-1>jP &3uPxюɾўhT " R& A|N1X_`={N"@1bXD*84B#1aAg;ڗGꊾhcgt轾g'^>A:S V'!!@14C͎@ P [ ÛEW̋҈C(ljx-E?y]@ϑ\QϦQhhh*#'H1,oڋ,{G$PIVv]v2&9|3smQ==M'ˡ. '5+އfG{zZ[FG6=jpC/_>A Ag!7k'i=&(=!;@$ղ & ]}ͽ.VG{=Nv}ꨳhhу]OG:.{X{)[D$PFe5H`X;-Z|Q'UQQ-5;f= m zto'HÀXŕHJGbtC _n%&dןZ=Ѷ8ڹo(\4#qO3ڶ{O`c'H!-ՙHFbl#  |e= Šu8Y1#:8(9K6+x`/h@]Ɨ3 `F%0x֧[>j}}˼SW55iVgg4@ͅxe=Ʋ%o%+ AZ3.$@$P6e1H .fD.V=(pL-Wh (R K$`#da-¹ -FhqmQǝ7DwAZ3ρ y4 `%xX7Q%7T5Nkj?DK&F翊=Xf@_~.cL HFbl#  P 6Skp˟?/o&\w](d\$.$@$P6e1Hb0&PN,{q`ѼgY^5B{(E^seHFbl# P 66kN{( NZՙHJGbtC MznYğio@]}7J!LrH1& 2,㨱$@P _ =~V4K{̍zD$Puo*I-*\Y.KfX~nWf ( L$`"l&F-hhd A m"(#2L$0}yUpW=B0rv~$@$P:26HD`{n|"zі`nBuPE,=wGo @ P qf Ql ܞy_Ҟ@H!H`ns`2 @P nȚϟҁ߿?zw -iڕ>vXZb.^={VӡKRNN1Xg1(7Pwꮖ܄-q9ŠJ2$@E#@1Xa{ 4/^e; L§'Fv&L,͛gl]/η ;v1jرcO~N1lyx> ΁C/5zIHŠ72SLiD2]6*"At@h;zø 8O&B4x{{lDwO1X -z}8=*f ў4~&y#f$@$kzkT('DR.| SB+~>ԋ%ePVoX !8[f/5C'_P+3*_0'?ܓ{kƝ> ^K/UkC$@ @1Xav'D@81YPNDXTsqgĿ奻*|quLz-|&e!fԺ&׺UKDW^? Y&nM L6YP]ϦuC]{x^j"\Hݎk7YuiKݝ_c6#- ~{eIH( 1 lD,XYDtK)D]Ez% (:ڥJgRNm+,Y".U (+VSpqtq*79G,}&WqTų_=dt}b0F N}~4%rL)ԔFb`"E8e:tY1O"N }&xu i6u<Ӗ;[]U# B,p16k*L"[ HtF013ԭJ9Gz.uDKlM?"8:L[}2NۧIHbKfuS *bP߂g[r}!%@c=!I8L^b&z?wdT6#s=]T! ,ܐA* JZD4$V}e&1&EF)He u3&IT0dXPUWUJ~&[kM-,Tqg[WE&k{ ~*w`19yuV?+ۨRViBxcEkڨ gJ.meQu7E;Խ.u .T =r\V# B,p1:*Ceд_Nw5EyS}oupc M1V7eR:Meo0I c(nXE ֨=Tb*O5L"bqmF?N $YlA|Or)"L/u%eE("&!x^/uC8Ai>'.7[6M¿kKIu.D]y."ϵ-N$@E%@1Xԑajz&ЀR\'ŒeKQu^Y1KX܅oҖ36=ڪgP=Wɺ8ԯgkAgK-TnI!˾ bDT"T˕.6I[yqr=I?XqbP-#& mm4GQ^oO~`vvi{uj @) P rؚjn:]ʼnAA""KģK+q]iSZ% Qۊk;Ȓ`-٣F5TWY^vEӖCejՕ>-"ny8JK(G]cu"20GL$-y[]RDZU vjrkn~"SC1{s; Js z|&dMPqqS؊qB9 !L]ʣ?ixm:P1H_o@7~; Ȑ&q!CwMS [9yߴP!8nEOruLo[$C.Kː @! P rXبdϚI *vQB\nx <wXE$TB q=3"9T za]CxAQ+{ukk:t:ٛ(z$(w t h`EI@r n"*z`zׂvZú<- `S|&i Ai " hDd4čͺB B5U$#"Jmͩ"bQChFEzQq4fQD6e0k?Pjj3건$@$ \" 0$E۔L`ʝsf˟I7P BCWK{\א]l Qw/. K?qZ6a/a$5%HKbcÖ $jaO1H.Q߃uu ,׸.Žץ^SR<HAbV $gQo18Ǣ\B0H&AS F@C{LTpW.VE$@'@1X" @bP߂OG󞽏{2z TkYHP∼z 漘z P 掘 7O>cwG_-~qb7P Nzh1K:v/X՝#Mb04QG$P?I_>"@LD!X9X (3$@$t]?3~1ꫢj)I,V $@%!pg)FY*8u" AZ 3_$?l& @,AN JG3 $uUQ\t-ݾW j#{A$` GS Ei/(u?_pO'̍7'/tꍫ[3><^z]ȫ\sIH(+1 @Sz¢X!W2{5/o} _ˆX_|eT_~c ?wMhƉz-|w7q% J0$@6wP :"Y*8y+e6,`?vkr'b #ރfuLcu\pIH2(+3 /S1X$kG!b37UPAAA<-:qu1.D0^/^6ֻlϡؒ @eP Vf( +EAhEB .BBE8wP%Q{61! O#,I[\)%[C$P%UMHH`޹,5P ~zs#_p@뉛b-.p9q75AK\Kw;kKE*K$@"@1XdgHL~|nbb@ng AI`q3g626rB<3+z8O;z,E1$@U#@1XeHFG3kzAXdkx!95'ĝR'e `5_D|!Ġk>gٿ5z’ @P Vj8 ]6,5PNEU$MTO/a|qT"K+Ukx>ך6H*GbrC 4kTѢ[<2݁M:ˎE(>5gPeK#D$_9_޷ u<=:W  );D$`#wZ3ZEDI>,bPO"AbLI2;~Ugy'rq% ܐC$@6_b,@ .{Š̙wL-51=ʨ $ϠBUz{m)+}v~.$@$PIVvHDÏޏCea";ovF9M=)aE9MayKC{I}6( k?XV1x'J$@$@1XaeHlsl@tM/! Y`C<-j܃61h7IXH*KbCˎM}B/LlxbthI^7JYh !it O:WA侙Fhyԛ-!Yp2IH(K;tlx# @,̛7MkwFs;vUرYܾ>ys%aYk`HúF[j/潆8 Ib0OD vww,W玉 AAa6eʔH=Atn"X=^{':]j1uNh8?%qU Rxw-U_? &'@1OG@\y|F .Ecǎ D9IOR{dV//Zw_+S'=VŔuIH(K=|l|AqKF VB"JBk„ Bɶ?4nM7GZEآ. ĝɅVҧ^utV*Uߎ:nE kIP RAZ ԓ`=iZ!*E@A,A@xgx"tI9A(vr8WĦjCPNH}!bNĤI Bԡ˧\Ktf0֫헿ii`bRz!:u=}Ͼ#˓ @ P }ؾB36Xn2ˤԡ1 FQg.Jl;9w#,q'g *#uSD|;od*u*ᜂUs F @h MTu 8@&q#u׃XRZ\rmtrڤ4M_&Bv3a[Σ*Y!W]}Ut]-ZW@'{!W]×gP"@}5M"Yf v::ŶF(,(ܞ2.Ul3 !@1#+! >m4fUpO*Hy_Web?HHŠ72@$PuC/l$(Bpm\@]y,wy$@$KbH4hqa3Z=(0.;BИ? 45~vHF/zfUɳh{h@W @l)@$@6.dp҉ҿZ4,.RiwRZZ \"@1i@$@Idw~Eл~  eH>#@1ș@$@1Ld` \2Ee=V*PF+֒9}?<  ?T  z0Z?w{N{NCy΁1,~{y$@$@$@$Fdh paqϡܾ,E$@MB&hvH CK-T it>Ŕ-M$@$@1XAeH㏣ $\wC)K%SEH$P~CHN~wgg6SS_'=TB-O~QU! r,x$@ &jL!H`7xIH(;6l @A =)kIP R ;fo>ӂ$l 4`ǀ- (NNTBlloXwVJ$@$P_ͫ T;/T;'>H!H`sYm  ȏ`~lY3 @ hㆦ誻ZJ%he ke++{$@$`HI =< (i,a:l&'@1όg 0;iD@٬WloxB 8tb$@$`#PpRmy1ݰ,*  XHlpi{hi^.P$@$@(=8 >2N^iD@^V&[p f HAb04B$@&?^s%Ci,y( @1O! TjA8yޕzX];i s9& (3$@$`"Png AZK1ܳ &@1(# VNvo'*HU9\WIH pe$@$`$ܼp*Ƚ7XϤ\OIH '9e$@$`#0xQ!ᲇ+ֺz wD)  P Ւ @k;*\wCi,À) @(sIHFAevZκɨ\7IH>(ÙW! #Ǐ=1"DN@Us  :eHHFׯ^7Ao=}{U.$@$@u$@1XGؼ wQ>I-.el͝s\ HHLby9 ܔ \}d AZ 7ܳ<:_pa  h@%IHFӏ?vpW=BpBVEk.$@$@ "@1 , gS'-*;;e];iMt7q!  h I*Ο?_ǗUPsB} hF8shxb/| {Zqq>vX]gϞ倲(#eSoo >)(CPBJ-Ϻ@1|x @(s*IL-D;Mvww!ec޼ye)#!Ǝ[SoF[&ܞJ8 b-s|x. @`:(*zAXTKaLD Š|&7a„S-hʔ)=AԲ>U+a/zVE^[zj!`=$@$`@Lb jdgx_?L奬J+nr;/cE!CUVeB{+HH U@ D,j8 ZcDAر#zFJzSK'|M +~ XBz^ aÓcἇ*HІ΁cڈ_~G$@ P HLbP;9~="!&n&aPiڈ@Ġ)Ϥo1Šky·D˾Qp5TrŶ:mny~Y7 "@1$!9BASĒJ,գI/]9‚K61qbD#ɍVʨڟ~wgQ  c{(- {#<HH( #FpLF^&ka\I.IJ\S VuzĠKO?8znܚ \S ce+ ;fo~vw @ @(:f*kOS䃫(,t& GS}oM "HEqp%ҵ^*sĩVQ 2X90цS׬HH ?e$P(>-1(.To0M>B>@y-!LMGEe ,Cî{|ɧ-"Ţvע8}ۋ{z$@$@P jHAtt~5TD^?SPN]Pe|mܸ 09Hg~FLm^HH 0Y hCLeeϝ.BO&jr35F <t%G=kz9/t>;o嵾i`q=)k $@1&""*EAx0yhSb3k3(FdFh/7U$aKNnKhl $@1&""*7U>y"Q&ˠӶwXDnDy쩮hEǸ܃>an`oxQK5z& @P VoL#ȝDLs!5`RD&Ȼl:s"h-Jr  &j+{E%)xÑ(-!NZ/0G$@P *H@PSP0X}zƒ,Ń-}e! hM2& $tmTxtMs ){D$@ "GjW]cWa$@$@KbyǞ=' XH\?P@"yys$@$@$Q r @ DdƈPs{"u  (9!HH0L \A!aA$@$@:A   oWRZ '1&  "@1\ޒ @p" .K#9m{nVH$@&@1XeHHdvO̥ Xi΋ @eP Vf( (FVB"/ k5$@$PFe5HJDgnc/ bcHL _Ϧ @ P `D Xڈ '7LY}`6J3}! ,ޘE$@$T x |`cH}ȃHHEb^y  gPx,Ue!`SH<%XHH 9@e$@$@ |BM@A$aUDK"<6>{H$@$`vHH n kiT;RE`\b `Fm%     @(d5$@$@$@$@$@$P&e-HHHHH Ր @P iV     Db0HVC$@$@$@$@$@e"@1Xb[IHHHHH @ Y `Fm%     @(d5$@$@$@$@$@$P&e-HHHHH Ր @P iV     Db0HVC$@$@$@$@$@e"@1Xb[IHHHHH @ Y `Fm%     @(d5$@$@$@$@$@$P&e-HHHHH Ր @P iV     Db0HVC$@$@$@$@$@e"@1Xb[IHHHHH @ Y `Fm%     @(d5$@$@$@$@$@$P&e-HHHHH Ր @P iV     Db0HVC$@$@$@$@$@e"@1Xb[IHHHHH @ Y `Fm%     @(d5$@$@$@$@$@$P&e-HHHHH Ր @P iV     Db0HVC$@$@$@$@$@e"@1Xb[IHHHHH @ Y `Fm%     @(d5$@$@$@$@$@$P&e-HHHHH Ր @P iV     Db0HVC$@$@$@$@$@e"`&ΎȀ 8888888888<_ ?IENDB` DdLj  FA?Picture 4b0 /Ί§J n /Ί§JPNG  IHDR,֟sRGBIDATx^_]}.BBm%d%FT"R/yTڵepy۱f[>/q7$L =峟m@ Ǐ/Gk׮|*|N?oŋ-/.|$08h;g}>:su[/޺;󛙡?G7 XZZz|go7^I?쯿~xÆ;.\ ԏܡG'Ot_}C, Cξ|{?5l>= ԛա_|A~woҗi@OgϞ꣏Niر=xN P7K /ܿz A Ѕ-|ԩSk. Ԛ׮$샵v!@ A`@?mjw: @T\  4 ĝ>@  @ $70@q@h ĽA%@˿R=wnia0 8o.^u5Q̥!@^Hۧ̾i@~-[F>بd8p @3]S1ٶmthh]/9^@h0r68\"=y&P]m^ɡ31 6rpZIW7!fct m=G'yg[ǞY*BIלK:Hfrr:IuCs?wwsɡΊ7T=ZۮTʹ9fe"*@fvq}GYS@e>9D̿D/+3 A@6vqa1D{_( @@vqa2,:^%cjgW<  ]wPg չ&  ]HߵRs2DYD8{ut@ `;SSa:a^b$ 8oq7db>  ʡ]PG{|ћQwIm\Y$0ttb@-C0ϡo$pɪW+Ӟ"shɡzE㹐rEkz^UOc6O@ ?{kdkٸQ ]?IUԦbm؞oTR@$լ1G 6RwT S] `wmEFG.YUO]@%rkisAd>=ݫ׹ҝ[5%븐 }+wp&]xv.z(BG@,i PeCC~)PvqWT-߮5oW`.Lje>]ܧ멢nnڴQB?@]ׯߨՐz14s0D.;vT_jfn @svqhk̮Jäd{s!o5iZ#m\{is7j͌]??uE0ExKevK8ݙ-YF[^^i9ve>]?LMTk]ɘV#P.`;^>rK5>4‹ ‘`Qp)Fg7ܔ?6嵜9+]h]s2:+jIhqӊ6(?6:\Rīw)h䀦eRKTr?lv,Gʋ`[.)Bs>rׄTSAyw_ 1L',rԁ i6툲љ;imvo\^rI?rP51Ɓ$?̵|  8p#:IeIї C5-1C]idHNͬё;9TS0 8n:x"1Ea@0,=~uƘ@%rGF43;;C'z*wK2SB@%&LdtD/f*;.Aa@H%fh" xNkN뻾鹓@ 4aёvN&4 @2GTs0l$l@7^?)'A@jT\bGE,lĽ9ēR {T4^8Ľp4@si2# K%x@hc*#n2Ʌ p@/qW^fVd x 9^ߣz/%̃uɊr.Cԝ=͞{6!HpbwKVU < XZen4W[i_Y2?4Jp.fgybehԱ\1[r9Tuu6j,6;vb?w6#j-ZKK_Gy-tܴ˓)k@1j$8jsAfw.L[<ul9-=UPi襣qK ^=kNCk9P5-eG:Ie-Pq\!2OzZ?ssGdwM)3R/:tj?E[bNuDY޲{i9qtVS So%h=>)^Uܝ]seuIj➨[q/c1sﲈN.n\^R$;Ld1:@j:IU!_.;w`Ok:=Uw$ 2E\6G.Z39i:xZr$  ]OO#:HcK2zHS9 XR28{Z|G.y~IT <  ]_laXVZ0`%<#`7jmgfcNXkQ:b.2 ]ʮ#1dжWڬ*wvq7yC^Ӓ[5u!{g8n!6;x@] v~R*+Sr 1~h<Kٵ&gb׮^6 Y@.eaNL[~ p#`GO.)L u8pnͳ;vT'ڑa{ULlnXijv$I&j7bs@Q+PJS i5'UMx4%*uhoݻ&N231{iu!ԝ}]c)N*gƤ1(o޼@e⮍t.&r-@@DW:t+u||TЉޤsFI@9 w3Ϯ-t w9qd5Ϸi@c =>!cΝ  ]dy, L.MQ|!`"hG_@FCUF~ssGaF;ȘY&~< (#+oTeܞ(@M Т^U+ʡ}f}=l WtzϡZ/-]eyYi9Sh@֯*r>3u8?9T"9w4gf =9Tr< O١mOϴ69Tr< 'qO@POD3^;6K1@M5䥽!g.S;86N1@X frxT4]2vIu C@@/q[>66]J7 @/qn%<\@6GG=lW TF*+  jk TLq8 PĽ \@s9@U@ܫ5 TLq8 PĽ \@9TsDU$khAPj9T% dL,yr6)$9T=uVWCєҦq-r u!;N"BBܳ%f7LS@hJw3^Lh_@+  d#P˦ԹKVlP "{|@ aТzXS.9ns'L&l[(#qOsǷ[_SWw"r8I#ڋKy/j34}gT.xa4C,އ9aCWŽ0eofF7l=D̘mbs: ڙWCp͝-ߞ eщKlG쌢ߵ?w=E~OظolUxdsZ!=u A([v9]0@ts}Xh ! Ѝ{!$ t @ $70@q@h ĽA%@;} f}V7m]/lF*w?TP=յ( XW1}v\p$;XC m'o_~<~9t R#M3̟ǎh&ܨ?Ľ1ă4$::"qw޽Hն]m= 19Ttx4P%@KK~k^Ee=yfY6/mY`ތ\Ke `CwSC'M$71ԓ:yQ=k\f2ݼC5kfLq9:V ΩMLL,>ڵm[}3h?woca $~")@u!L]"R@S( @) E!ԅ^Ha' ( @.D ;! EQ@u!%R @ =,B eq_ZZ @ I[}ExA@ ,,, . M_}#.K@UW]%aܾ^y_Nx( Pwssv) ?s{ŋu !L… z`n}~[k? !ԝ̙[}@U?7n;7=Cuw!H?gs)RH#}я&W~?{l\p@M hOիsIY>ڵkoo+_{Æv~sk-fCh6w9vhɓsgΜkן^>n?q׭Oh h\~W_xLJn?zdn|͛opf=8% ۱f[>/ܱn 2f4IENDB`$$If!vh5"5#v"#v:V l, t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065$$If!vh5"5#v"#v:V l t065!h000(8XV~ OJPJQJ_HmH nH sH tH D`D /NormalCJ_HaJmH sH tH jj I Heading 1$ F<@&a$&5CJ KH OJPJQJ\aJ mH sH `@`  & Heading 3$$@&5B*OJPJQJ\^JphODA`D Default Paragraph FontRi@R 0 Table Normal4 l4a (k ( 0No List DD "W Balloon TextCJOJQJaJ^^ IHeading 1 Char*5CJ KH OJPJQJ\^JaJ mH sH 8@8 Header!>!>  Header CharOJPJQJ^J8 28 Footer!>A>  Footer CharOJPJQJ^J.)@Q.  Page NumberVbV Colorful List - Accent 11 ^m$N^@rN #(0 Normal (Web)dd[$\$ OJPJQJ*W@* #(`Strong5\6U@6 #( Hyperlink >*B*phROR fbodytextdd[$\$OJPJQJmHsHtHb@b i(+ List Paragraphd^m$CJOJPJQJaJmHsHT`T i(+ No Spacing$CJOJPJQJ_HaJmHsHtH 0a0 %Q0 HTML Cite6]e Y60HTML Preformatted;2( Px 4 #\'*.25@9CJOJPJQJ^JaJTT Y60HTML Preformatted CharOJPJQJ^J\\ &Heading 3 Char'5B*CJOJPJQJ\^JaJphOPK![Content_Types].xmlj0 u$Nwc$ans@8JbVKS(.Y$8MVgLYS]"(U֎_o[gv; f>KH|;\XV!]օ Oȥsh]Hg3߶PK!֧6 _rels/.relsj0 }Q%v/C/}(h"O = C?hv=Ʌ%[xp{۵_Pѣ<1H0ORBdJE4b$q_6LR7`0̞O,En7Lib/SeеPK!kytheme/theme/themeManager.xml M @}w7c(EbˮCAǠҟ7՛K Y, e.|,H,lxɴIsQ}#Ր ֵ+!,^$j=GW)E+& 8PK!\theme/theme/theme1.xmlYOoE#F{o'NDuر i-q;N3' G$$DAč*iEP~wq4;{o?g^;N:$BR64Mvsi-@R4Œ mUb V*XX! cyg$w.Q "@oWL8*Bycjđ0蠦r,[LC9VbX*x_yuoBL͐u_. DKfN1엓:+ۥ~`jn[Zp֖zg,tV@bW/Oټl6Ws[R?S֒7 _כ[֪7 _w]ŌShN'^Bxk_[dC]zOլ\K=.:@MgdCf/o\ycB95B24S CEL|gO'sקo>W=n#p̰ZN|ӪV:8z1f؃k;ڇcp7#z8]Y / \{t\}}spķ=ʠoRVL3N(B<|ݥuK>P.EMLhɦM .co;əmr"*0#̡=6Kր0i1;$P0!YݩjbiXJB5IgAФ޲a6{P g֢)҉-Ìq8RmcWyXg/u]6Q_Ê5H Z2PU]Ǽ"GGFbCSOD%,p 6ޚwq̲R_gJSbj9)ed(w:/ak;6jAq11_xzG~F<:ɮ>O&kNa4dht\?J&l O٠NRpwhpse)tp)af] 27n}mk]\S,+a2g^Az )˙>E G鿰L7)'PK! ѐ'theme/theme/_rels/themeManager.xml.relsM 0wooӺ&݈Э5 6?$Q ,.aic21h:qm@RN;d`o7gK(M&$R(.1r'JЊT8V"AȻHu}|$b{P8g/]QAsم(#L[PK-![Content_Types].xmlPK-!֧6 /_rels/.relsPK-!kytheme/theme/themeManager.xmlPK-!\theme/theme/theme1.xmlPK-! ѐ' theme/theme/_rels/themeManager.xml.relsPK] m  -OOOOOR^#sv,>/GtKIPUWXXXG[^ci riuu=@LXZ[\]_abceghjoxyz|}~ ^uk]%W5e9\w{/PJRWZXXXX'YAYZYjYYYYG[Yduu>?ABCDEFGHIJKMNOPQRSTUVWY^`dfiklmnpqrstuvw{.T=r766c6w6888~<<<$RiRRqUUUab bmXXXXXXXXXXXX!(*BIKR!!@,b$~/S+# AA@$(    FA?"Picture 1#" ?B S  ?9m tu tmmmm6:n%%kmkmmmmmnmnmpmqmsmtmvmwmmm|~ty9LnFFQQZZ]]g$gggh%hwiyikmkmmmmmnmnmpmqmsmtmvmwmmm:::::::::::::wy'hnfV>PЗ P)XTl6"I(kYzmMzpl6 0b}n(<mdr+Qpw:Rwyyge P)                                    ʃVxIt Hx^pN"<2                                             6_ }f4v9"9"mZ79" 4TsS|9" U9MRXY^abgklquv{* + \ a k l s x      T W ] ^   % & M Q W X Y + / 5 6 [ _ e f 6789:PPPPPPPPPPPPPP$Q'Q(Q>QAQBQWQZQ[QgQjQkQQQQQQQQQQkmmmpmsmvmmmzL@m@Unknown GTimes New Roman5Symbol3 Arial;Helvetica7Cambria7Calibri? Courier New7 VerdanaCLucida Grande;Wingdings#1'9Kf9Kf8Z .T] /$x4dnkm :#QH?/2 xxPauline SimpsonPeter PissierssensH           Oh+'0p  , 8 DPX`h'Pauline Simpson Normal.dotmPeter Pissierssens2Microsoft Macintosh Word@F#@?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijlmnopqrstuvwxyz{|}~Root Entry F0#PData 1TablekQWordDocument(SummaryInformation(DocumentSummaryInformation8CompObj` F Microsoft Word 97-2004 DocumentNB6WWord.Document.8